PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.008G181000.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ARR-B
Protein Properties Length: 534aa    MW: 60065.8 Da    PI: 6.0387
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.008G181000.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like77.31.9e-24157210155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k+r++W+ +LH++Fv+av+q+ G +k  Pk+il++m+v+ Lt+e+v+SHLQkYRl
  Potri.008G181000.2 157 KARVVWSVDLHQKFVKAVNQI-GFDKVGPKKILDMMNVPWLTRENVASHLQKYRL 210
                         68*******************.9*******************************8 PP

2Response_reg54.95e-1978532109
                         HHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHHHHH CS
        Response_reg  32 geealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdpeelvk 109
                         +++al+ll+e++  +D+++ D+ mp+mdG++ll++   e  +lp+i+++  ge + + + ++ Ga d+l Kp+ ++el++
  Potri.008G181000.2   7 ARDALNLLRERKggYDIVISDVYMPDMDGFKLLEQVGLEM-DLPVIMMSVDGETSRVMKGVQHGACDYLLKPIRMKELRN 85 
                         6899****999999**********************6644.8***********************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011031.984191IPR001789Signal transduction response regulator, receiver domain
SMARTSM004482.2E-4187IPR001789Signal transduction response regulator, receiver domain
PIRSFPIRSF0363921.1E-1191473IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23004.1E-302108No hitNo description
CDDcd001564.02E-20291No hitNo description
PfamPF000721.2E-15786IPR001789Signal transduction response regulator, receiver domain
SuperFamilySSF521723.42E-237106IPR011006CheY-like superfamily
SuperFamilySSF466893.4E-17155214IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.3E-28155215IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-21157210IPR006447Myb domain, plants
PfamPF002496.7E-8159209IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 534 aa     Download sequence    Send to blast
MTTCGLARDA LNLLRERKGG YDIVISDVYM PDMDGFKLLE QVGLEMDLPV IMMSVDGETS  60
RVMKGVQHGA CDYLLKPIRM KELRNIWQHV FRKKIHEVRD IETLERVESF QMTRNGSDQY  120
EDGHVLCGED LTSIKKRKHI ESKHDEKDTG DSISTKKARV VWSVDLHQKF VKAVNQIGFD  180
KVGPKKILDM MNVPWLTREN VASHLQKYRL YLSRLQKEND FKNPAGGIKQ SDSPLRDSAG  240
SFGSQNSINL QHNDVSNGSY RFSGSSLVVH NGDPRSHDSD RKRLVSTPVE EPKRTLTVNV  300
PNPCIPRSSQ MEFGHPLAPP QSEVDFGALD STFPTKYPWC GIPEIQLKKE HNPLHLNDEF  360
SHLPLPGQKQ LTQADYPQPA PAISSAPSLT PSHNEYRSNV NHASSTAIAV DSSPIQTKTN  420
VANHQAIELI SKSTPSLENQ GFNMNSITEF ESSRKNINLG MLPFTTLEED LQVCWVPGDC  480
YMNLGLQNIE VLEYFDPGLI TDVPVNLNDG LRFDYEFNDP TEYSLIDQSL FIA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-17154215263ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.008G181000.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFN9081450.0FN908145.1 Populus x canadensis mRNA for putative B-type response regulator 14 (rr14 gene), cultivar Dorskamp.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024463384.10.0two-component response regulator ARR11 isoform X3
TrEMBLA0A2K1ZJ900.0A0A2K1ZJ90_POPTR; Two-component response regulator
STRINGPOPTR_0008s18130.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67710.11e-107response regulator 11