PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.008G179700.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Trihelix
Protein Properties Length: 352aa    MW: 39940.1 Da    PI: 7.276
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.008G179700.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix85.28.3e-2777158286
            trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                         W ++e++ Li +rrem+  ++++k++k+lWe++s kmr++gf rsp++C++kw+nl k++kk k+++++     s +++y+++++
  Potri.008G179700.3  77 WVQDETRSLIGFRREMDGLFNTSKSNKHLWEQISTKMRDKGFDRSPTMCTDKWRNLLKEFKKAKHQDRGS---GSAKMSYYKEID 158
                         ********************************************************************84...556899***997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.5E-467138IPR009057Homeodomain-like
PROSITE profilePS500908.28169133IPR017877Myb-like domain
SMARTSM007170.009773135IPR001005SANT/Myb domain
CDDcd122031.38E-2875140No hitNo description
PfamPF138375.8E-2176160No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MYLSEKPRPL DFYKEEVGPS SSRDNMIIEV VSSNGDLPPL HLHPITAATN PHQMILGESS  60
GDDNHEVKAP KKRAETWVQD ETRSLIGFRR EMDGLFNTSK SNKHLWEQIS TKMRDKGFDR  120
SPTMCTDKWR NLLKEFKKAK HQDRGSGSAK MSYYKEIDEI LRGRNKNSQY KCPTPKVDSY  180
MQFSDKGFED TSISFGPVEA SARPTLNLER RLDHDGHPLA ITAADAVAAS GVPPWNWRET  240
PGNGAESQSF GGRVISVKSG DYTRRIGIDG TTDAIREAIK SAFRLRTKRA FWLEDEDQII  300
RALDRDMPLG NYTLHLDEGN LCIYCHILIK SFLYVFNCLT KDCEIRDCEI L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2jmw_A8e-5271156186DNA binding protein GT-1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.9250.0bud| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011029632.10.0PREDICTED: trihelix transcription factor GT-1 isoform X3
SwissprotQ9FX531e-160TGT1_ARATH; Trihelix transcription factor GT-1
TrEMBLB9HLA70.0B9HLA7_POPTR; DNA-binding protein GT-1
STRINGPOPTR_0008s17980.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13450.11e-161Trihelix family protein