PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.008G149100.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Whirly
Protein Properties Length: 223aa    MW: 24398.7 Da    PI: 10.1951
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.008G149100.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly119.71.8e-37129212184
              Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakg 84 
                         s+yk+kaal+v+++ p+f+ ldsg+ kl ++G++ll++a+a+++r+ydW +kq+f+ls+te+++lv+l +k+sceffhdp +++
  Potri.008G149100.2 129 SIYKGKAALTVEPRSPEFSPLDSGAYKLVKEGFVLLQFAPAASVRQYDWTRKQVFSLSVTEIGHLVSLDAKGSCEFFHDPNKGK 212
                         7*******************************************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.101.9E-41118213IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544472.2E-34122213IPR009044ssDNA-binding transcriptional regulator
PfamPF085362.0E-35130213IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0032211Biological Processnegative regulation of telomere maintenance via telomerase
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045910Biological Processnegative regulation of DNA recombination
GO:0009508Cellular Componentplastid chromosome
GO:0009570Cellular Componentchloroplast stroma
GO:0003697Molecular Functionsingle-stranded DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003723Molecular FunctionRNA binding
GO:0042162Molecular Functiontelomeric DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MGMGSWPMDG SINLSVSILD LSSPSSLSVS GSTKKREERG KMLQLNSVSR VSSSPQNPKL  60
WLPQYNSLCS TKSISLNSKT SSTEKKKTLG VKCQYYDQQH KTFTTSSRSS PSSAPPVGES  120
PPKVFVGHSI YKGKAALTVE PRSPEFSPLD SGAYKLVKEG FVLLQFAPAA SVRQYDWTRK  180
QVFSLSVTEI GHLVSLDAKG SCEFFHDPNK GKRCSKQSFE YR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1l3a_A6e-5211821232126p24: plant transcriptional regulator PBF-2
1l3a_B6e-5211821232126p24: plant transcriptional regulator PBF-2
1l3a_C6e-5211821232126p24: plant transcriptional regulator PBF-2
1l3a_D6e-5211821232126p24: plant transcriptional regulator PBF-2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.114720.0leaf| stem
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1464070.0EF146407.1 Populus trichocarpa clone WS0117_P12 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002311601.11e-121hypothetical protein POPTR_0008s14840g
SwissprotQ9LL858e-54WHY1_SOLTU; Single-stranded DNA-binding protein WHY1, chloroplastic
TrEMBLA9PDN01e-121A9PDN0_POPTR; Uncharacterized protein
STRINGPOPTR_0008s14840.11e-120(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02740.11e-48ssDNA-binding transcriptional regulator