PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.008G135500.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 621aa    MW: 66852.5 Da    PI: 7.1325
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.008G135500.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like894.3e-28172225155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kpr++W+ eLH++Fv+av++L G++kA+Pk+ilelm+v+gLt+e+v+SHLQk+Rl
  Potri.008G135500.2 172 KPRVVWSVELHQQFVSAVNHL-GIDKAVPKRILELMNVPGLTRENVASHLQKFRL 225
                         79*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011015.411103IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23006.2E-53667No hitNo description
SuperFamilySSF521721.57E-1237114IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23002.0E-1168123No hitNo description
Gene3DG3DSA:1.10.10.601.8E-29169230IPR009057Homeodomain-like
PROSITE profilePS5129410.954169228IPR017930Myb domain
SuperFamilySSF466892.51E-19170229IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-24172225IPR006447Myb domain, plants
PfamPF002492.0E-6174223IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 621 aa     Download sequence    Send to blast
MAALQRVAPS LGTSASTYGS CKGAGADVIV SDQFPAGLRV LVVDDDITCL RLLEKMLRRC  60
LYHVMSADGR TSAVMRGISH GACDYLIKPI REEELKNIWQ HVIRKKWNEN KEQEHSGSFE  120
DNDRHKRGND AENASSVSEG AEGVLKGQKK RSIAKDEDDA ELENDDPSAS KKPRVVWSVE  180
LHQQFVSAVN HLGIDKAVPK RILELMNVPG LTRENVASHL QKFRLYLKRL SGVAQQGGIS  240
NPFCGLLDSN VKLNPLGRFD IQVLAASGQI PPQTLAALHA ELFGHPAGSM VTTVDQPALL  300
QASVQGPKCI PAEHGMAFGQ PLVKCQTNMS KHFPQNVVSA EEVATGFVAW PSNSVGTVGP  360
ISNLGGMSSK NSNMLMDVVQ QQKQQQQSPQ LPSLPEPSRI INVQPSCLVV PSQSSATFQA  420
GNSPASVNQN CSYSRSPMID YSLLSPQSNN SSLNIGQISN GDLKTTGVSG YSGSGSISPL  480
SSCSVNPDNT SQQGQSSTMT IRAARQLPGL GPNISNFQGS YGAKSSEVLD QGPLRNLGFV  540
GKCTSIPSRL AVDEFESTMS NLEHEKLYME TNGNKVKQEP NSNAVKQEPN VEFMDNAKVL  600
IPILPQLPPN TSDLMSVFKE *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-24168231164ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.008G135500.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFN9081400.0FN908140.1 Populus x canadensis mRNA for putative B-type response regulator 15 (rr15 gene), cultivar Dorskamp.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002311532.20.0two-component response regulator ORR21
SwissprotA2XE311e-123ORR21_ORYSI; Two-component response regulator ORR21
SwissprotQ8H7S71e-123ORR21_ORYSJ; Two-component response regulator ORR21
TrEMBLD7GN450.0D7GN45_POPCA; Two-component response regulator
STRINGPOPTR_0008s13490.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.19e-82response regulator 1
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]