PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.008G131700.1
Common NamePOPTR_0008s13090g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 601aa    MW: 65956.3 Da    PI: 5.5196
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.008G131700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS465.14.1e-1422325891374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         lv+lL++cAeav++++++la+al++++  la +++  m+++a+yf+eALa+r+++        l p+++++++ s+ l++   f+e++P+l
  Potri.008G131700.1 232 LVHLLMACAEAVQESNFTLAEALVKQIGFLAVSQAGVMRKVATYFAEALARRIYK--------LCPQNSTDHSLSDILQI--HFYETCPYL 312
                         68*****************************************************........66666665566666555..4******** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlv 182
                         kf+h+taNqaIlea+eg++rvH+iDf+++qG+QWpaL+qaLa Rp+gpp +R+Tg+g+p++++++ l+e+g++La++Ae+++v+fe++ +v
  Potri.008G131700.1 313 KFAHFTANQAILEAFEGKKRVHVIDFSMNQGMQWPALMQALAVRPGGPPAFRLTGIGPPAHDNTDHLQEVGWKLAQLAETIHVEFEYRGFV 403
                         ******************************************************************************************* PP

                GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdslea 273
                         a++l+dl+ ++L+++p E++aVn+v++lh+ll++++++e+    vL++vk+++P++v+vveqea+hn++ Fl+rf+e+l+yys+lfdsle 
  Potri.008G131700.1 404 ANSLADLDASMLELRPTESVAVNSVFELHKLLSRPGAIEK----VLSVVKQMKPEIVTVVEQEANHNGPIFLDRFTESLHYYSTLFDSLEG 490
                         ********************************99999999....*********************************************** PP

                GRAS 274 klpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWk 363
                         ++   s +++ +++++lg++i+nvvaceg +r+erhetl +Wr rl++aGF pv+l+++a kqa++ll+ ++ +dgyrvee++g+l+lgW+
  Potri.008G131700.1 491 SV---STQDKIMSEVYLGKQICNVVACEGPDRVERHETLTQWRTRLGSAGFAPVHLGSNAFKQASMLLALFAgGDGYRVEENNGCLMLGWH 578
                         *7...99999********************************************************************************* PP

                GRAS 364 drpLvsvSaWr 374
                         +rpL+++SaWr
  Potri.008G131700.1 579 TRPLIATSAWR 589
                         **********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120411.4E-3654120IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011294.1E-3754127No hitNo description
PROSITE profilePS5098568.571206568IPR005202Transcription factor GRAS
PfamPF035141.4E-139232589IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0010218Biological Processresponse to far red light
GO:0042176Biological Processregulation of protein catabolic process
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 601 aa     Download sequence    Send to blast
MKREHPNLHP QQISDPSTLA AAGYSTSTSA MAPHNGKAKI WEEGEGHQAD GGMDELLAVL  60
GYKVRSSDMA EVAQKLEQLE EVMGHAQEDG LSHLASDSVH YNPSDLSTWL ESMISELNPN  120
LNFDPSADSL LAPAESSTIT SIDFSDHKHH QQQKLFEESS SSDYDLKVIP GKAVFSQTQI  180
DSRESKRLKT DLYQTSSSSS LSSATTLGSF GISTESTRPV VLVDSQENGI RLVHLLMACA  240
EAVQESNFTL AEALVKQIGF LAVSQAGVMR KVATYFAEAL ARRIYKLCPQ NSTDHSLSDI  300
LQIHFYETCP YLKFAHFTAN QAILEAFEGK KRVHVIDFSM NQGMQWPALM QALAVRPGGP  360
PAFRLTGIGP PAHDNTDHLQ EVGWKLAQLA ETIHVEFEYR GFVANSLADL DASMLELRPT  420
ESVAVNSVFE LHKLLSRPGA IEKVLSVVKQ MKPEIVTVVE QEANHNGPIF LDRFTESLHY  480
YSTLFDSLEG SVSTQDKIMS EVYLGKQICN VVACEGPDRV ERHETLTQWR TRLGSAGFAP  540
VHLGSNAFKQ ASMLLALFAG GDGYRVEENN GCLMLGWHTR PLIATSAWRL NTNQPVVGAA  600
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-542325894375GRAS family transcription factor containing p
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00611ChIP-seqTransfer from AT2G01570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX1024710.0JX102471.1 Populus tomentosa DELLA domain GRAS family transcription factor GAI mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002312450.20.0hypothetical protein POPTR_0008s13090g
SwissprotQ6EI050.0GAIPB_CUCMA; DELLA protein GAIP-B
TrEMBLB9HJD20.0B9HJD2_POPTR; Uncharacterized protein
STRINGPOPTR_0008s13090.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12511550
FabidsOGEF80334121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.10.0GRAS family protein