PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.008G129500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 233aa    MW: 25573 Da    PI: 8.2888
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.008G129500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.52.2e-1869123256
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         rk+ +++keq + Lee F+++++++ +++e LA +l+L  rqV vWFqNrRa+ k
  Potri.008G129500.1  69 RKKLRLSKEQSRLLEESFRQHHTLNPRQKEALALQLKLRPRQVEVWFQNRRARSK 123
                         788899***********************************************98 PP

2HD-ZIP_I/II117.86.2e-3869157190
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                         +kk+rlskeq++lLEesF+++++L+p++K++la +L+l+prqv+vWFqnrRAR k+kq+E+++e+Lkr++ +l+e+n+rL++eveeLr +
  Potri.008G129500.1  69 RKKLRLSKEQSRLLEESFRQHHTLNPRQKEALALQLKLRPRQVEVWFQNRRARSKLKQTEMECEYLKRWFGSLTEQNRRLQREVEELR-A 157
                         69*************************************************************************************9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.9E-1854123IPR009057Homeodomain-like
SuperFamilySSF466891.67E-1857126IPR009057Homeodomain-like
PROSITE profilePS5007116.74665125IPR001356Homeobox domain
SMARTSM003891.4E-1667129IPR001356Homeobox domain
CDDcd000863.22E-1668126No hitNo description
PfamPF000461.1E-1569123IPR001356Homeobox domain
PROSITE patternPS000270100123IPR017970Homeobox, conserved site
PfamPF021831.2E-9125159IPR003106Leucine zipper, homeobox-associated
SMARTSM003409.1E-23125168IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MAVSPSSISS LELTISMPGF SSSPPCPSSE VCAVKDLDIN QLPSGTGEEE WITAGMEDEE  60
ESTNGGPPRK KLRLSKEQSR LLEESFRQHH TLNPRQKEAL ALQLKLRPRQ VEVWFQNRRA  120
RSKLKQTEME CEYLKRWFGS LTEQNRRLQR EVEELRALKV GPPTVMSPHS CEPLPASTLT  180
MCPSCERVTT TGLDKGSTKT TTTAVATPTT AATLSSKVGT PALQSRQSSA AC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1117125RRARSKLKQ
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, leaves, nodes, internodes, flowers and embryo. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:17999151}.
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, leaves, nodes, internodes, flowers and embryo. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription repressor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
UniProtProbable transcription repressor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.008G129500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024462430.11e-168homeobox-leucine zipper protein HOX3 isoform X1
SwissprotQ0JKX14e-82HOX3_ORYSJ; Homeobox-leucine zipper protein HOX3
SwissprotQ9XH384e-82HOX3_ORYSI; Homeobox-leucine zipper protein HOX3
TrEMBLA0A2K1ZGB61e-167A0A2K1ZGB6_POPTR; Uncharacterized protein
STRINGPOPTR_0010s12300.11e-133(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95063040
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01430.11e-67homeobox-leucine zipper protein 17