PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.008G097900.1
Common NamePOPTR_0008s09750g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family SBP
Protein Properties Length: 511aa    MW: 55865.5 Da    PI: 7.5264
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.008G097900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.63.2e-42165240277
                         -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                 SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                         Cqv gC++dls+ k+yh+rhkvCevhsk+p+v+v+g eqrfCqqCsrfh l +fD++krsCr+rLa+hnerrrk+q
  Potri.008G097900.1 165 CQVYGCNKDLSSSKDYHKRHKVCEVHSKTPQVIVDGNEQRFCQQCSRFHLLVDFDDGKRSCRKRLAGHNERRRKPQ 240
                         **************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.8E-32160226IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.214162239IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.63E-39163244IPR004333Transcription factor, SBP-box
PfamPF031105.4E-32165238IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 511 aa     Download sequence    Send to blast
MDFWSYASEG KGLLFSDEID LSVDAFARSR KTLIGWDTES VESTEFIDFG FSEIPRKPFH  60
GSKTGVGMLG GTDGGIDSSK LVASSPNCMI ASNSSMESGS NHSNSLVESN SQDSSLIDLK  120
LGRLADFKDA QNSKFSKERL LSSVSPTAQA KRARATCSRP QTTYCQVYGC NKDLSSSKDY  180
HKRHKVCEVH SKTPQVIVDG NEQRFCQQCS RFHLLVDFDD GKRSCRKRLA GHNERRRKPQ  240
LGTLSVKPHK LLHPYQGTKF LGTSLPKKTS LLFPNMLPGS AFCPGNYEEE NWCRRIKLEE  300
NSIYSSPSAI PMGNGQLLPK SFLHLHGNGL QKTCGISSPA IDDRNFCNTT TFHELAGASH  360
SSCALSLLSA ESQDLSHSAG NITARPLVSQ VSHACQSLGN VNKSLGVGSL EKYFPNGLYP  420
SGMNFIEVND MGPFVVPGSG HAADFQVETD GFLQQSDILN AKYGVSPENG STVDLLQLSS  480
HLQRVEQQRN SMQVKHENEE FCSFGSTYGV *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-281652381184squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.008G097900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002312291.20.0squamosa promoter-binding-like protein 6
RefseqXP_024461811.10.0squamosa promoter-binding-like protein 6
TrEMBLB9HIG50.0B9HIG5_POPTR; Uncharacterized protein
STRINGPOPTR_0008s09750.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.11e-48SBP family protein