PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.008G088200.1
Common NamePOPTR_0008s08780g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family M-type_MADS
Protein Properties Length: 364aa    MW: 40463.7 Da    PI: 7.1697
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.008G088200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF64.98.4e-211053245
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                        + en+  rq t++kR++gi+KKA+ELS+LCd+++ +++fs+tgk
  Potri.008G088200.1 10 KLENTNGRQATYAKRKHGIMKKANELSILCDIDIILLMFSPTGK 53
                        6799**************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.563153IPR002100Transcription factor, MADS-box
SMARTSM004323.6E-27160IPR002100Transcription factor, MADS-box
CDDcd002663.62E-26282No hitNo description
SuperFamilySSF554559.81E-25295IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-16323IPR002100Transcription factor, MADS-box
PfamPF003193.3E-181154IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-162338IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-163859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MGRVKLKIKK LENTNGRQAT YAKRKHGIMK KANELSILCD IDIILLMFSP TGKPSLCKGA  60
SSSIEEVITK FAQLTPQERA KRKLESLEAL KKTFKKLDHD VNIPEFLGTS SQTIEDLTSQ  120
SRLLQNQLSD VHKKLSYWTN PDEISSLEHL GQLESSLRES LNRIRSHKEH LGKQHLMSLE  180
CHSQFQNAMH VPFRMGVEQQ LPPISWIPNT DSQHIMLPED PNLLPHRDAE CSATTSFGSY  240
SGYFGAGKNS ELSSSGQESG MNGILDEFNG TASLRLQMAG QYPYLPGSYN LNLLNDSKFQ  300
PAAEMKTQKS PEDFHVNGSF EAPKPGYDST PCGWASTPGS CAVTMFDDHL YSQENATSTL  360
QKP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A2e-14192190MEF2 CHIMERA
6byy_B2e-14192190MEF2 CHIMERA
6byy_C2e-14192190MEF2 CHIMERA
6byy_D2e-14192190MEF2 CHIMERA
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in pollen. {ECO:0000269|PubMed:12949148}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms heterodimers with the MADS-box proteins AGL66 and AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.008G088200.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024462481.10.0agamous-like MADS-box protein AGL30 isoform X3
SwissprotQ1PFA41e-120AGL30_ARATH; Agamous-like MADS-box protein AGL30
TrEMBLB9HI830.0B9HI83_POPTR; Uncharacterized protein
STRINGPOPTR_0008s08780.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27503370
Representative plantOGRP59461119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.21e-100AGAMOUS-like 30
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]