PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.008G087800.1
Common NamePOPTR_0008s08740g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Dof
Protein Properties Length: 501aa    MW: 54067.2 Da    PI: 6.953
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.008G087800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.96.2e-40142202262
              zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                         ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+ss
  Potri.008G087800.1 142 PDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKSSS 202
                         7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-31139199IPR003851Zinc finger, Dof-type
PfamPF027012.8E-32144200IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.947146200IPR003851Zinc finger, Dof-type
PROSITE patternPS013610148184IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 501 aa     Download sequence    Send to blast
MSDLAIKLFG KTIPLQVNQQ EDVSCAANKY ESSSGTPPES EDCYDNTATA TSSQENHNSH  60
KERGEQEGNN NRETSGEEIA NDKQEDVTSN QINKDSKGPT SSGISENPKT PSAERETSSL  120
KSSKNEEQSE TSISQEKTLK KPDKILPCPR CNSMDTKFCY YNNYNVNQPR HFCKNCQRYW  180
TAGGTMRNVP VGAGRRKNKS SSASHYRHLM VSEALRTAQV HAMNGFHNPS LGNNGTVLTF  240
GSDSPLCESV ASVLNLSEKT QNSVRNGYHR PEHRILVSCG GTGGDGDDHS SVSSATASNS  300
SEKGCNGTSR EAVNKDYQSF PPQAPCFPGP PWPYPWNSAI TPPTFCPSGF PVSFFPAPAY  360
WGCTVPSPWN VPPCASSPSA TLNHSTQSSS PTFPLGKHSR DGNILNPPCL EEPSRDGTKS  420
ETGVLVPKTL RIDDPSEAAK SSIWATLGIT NEKSSSINGG GLFKGFQSKS EDRNYMAGTT  480
SVLQANPAAF SRSLNFHENT *
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.008G087800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU2863040.0GU286304.1 Populus balsamifera isolate FBK13 haplotype A Dof zinc finger protein gene, partial sequence.
GenBankGU2863050.0GU286305.1 Populus balsamifera isolate FBK13 haplotype B Dof zinc finger protein gene, partial sequence.
GenBankGU2863060.0GU286306.1 Populus balsamifera isolate FRE01 haplotype A Dof zinc finger protein gene, partial sequence.
GenBankGU2863070.0GU286307.1 Populus balsamifera isolate FRE01 haplotype B Dof zinc finger protein gene, partial sequence.
GenBankGU2863080.0GU286308.1 Populus balsamifera isolate GIL14 haplotype A Dof zinc finger protein gene, partial sequence.
GenBankGU2863090.0GU286309.1 Populus balsamifera isolate GIL14 haplotype B Dof zinc finger protein gene, partial sequence.
GenBankGU2863100.0GU286310.1 Populus balsamifera isolate HAY07 haplotype A Dof zinc finger protein gene, partial sequence.
GenBankGU2863110.0GU286311.1 Populus balsamifera isolate HAY07 haplotype B Dof zinc finger protein gene, partial sequence.
GenBankGU2863120.0GU286312.1 Populus balsamifera isolate INU03 haplotype A Dof zinc finger protein gene, partial sequence.
GenBankGU2863130.0GU286313.1 Populus balsamifera isolate INU03 haplotype B Dof zinc finger protein gene, partial sequence.
GenBankGU2863140.0GU286314.1 Populus balsamifera isolate KUU07 haplotype A Dof zinc finger protein gene, partial sequence.
GenBankGU2863150.0GU286315.1 Populus balsamifera isolate KUU07 haplotype B Dof zinc finger protein gene, partial sequence.
GenBankGU2863160.0GU286316.1 Populus balsamifera isolate MGR10 haplotype A Dof zinc finger protein gene, partial sequence.
GenBankGU2863170.0GU286317.1 Populus balsamifera isolate MGR10 haplotype B Dof zinc finger protein gene, partial sequence.
GenBankGU2863180.0GU286318.1 Populus balsamifera isolate POR11 haplotype A Dof zinc finger protein gene, partial sequence.
GenBankGU2863190.0GU286319.1 Populus balsamifera isolate POR11 haplotype B Dof zinc finger protein gene, partial sequence.
GenBankGU2863200.0GU286320.1 Populus balsamifera isolate RNA13 haplotype A Dof zinc finger protein gene, partial sequence.
GenBankGU2863210.0GU286321.1 Populus balsamifera isolate RNA13 haplotype B Dof zinc finger protein gene, partial sequence.
GenBankGU2863220.0GU286322.1 Populus balsamifera isolate WHR03 haplotype A Dof zinc finger protein gene, partial sequence.
GenBankGU2863230.0GU286323.1 Populus balsamifera isolate WHR03 haplotype B Dof zinc finger protein gene, partial sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006379668.20.0cyclic dof factor 2
TrEMBLA0A2K1ZE600.0A0A2K1ZE60_POPTR; Uncharacterized protein
STRINGPOPTR_0008s08740.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62534147
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.18e-79cycling DOF factor 3