PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.008G087600.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 323aa    MW: 36023.5 Da    PI: 6.7424
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.008G087600.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.65.9e-331771155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprl+Wt+eLH+rFveav+qLGG++kAtPk+++++m+++gLtl+h+kSHLQkYRl
  Potri.008G087600.2 17 KPRLKWTQELHQRFVEAVNQLGGADKATPKSLMRVMGIPGLTLYHLKSHLQKYRL 71
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.3991474IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.1E-311573IPR009057Homeodomain-like
SuperFamilySSF466895.02E-171672IPR009057Homeodomain-like
TIGRFAMsTIGR015573.6E-231772IPR006447Myb domain, plants
PfamPF002497.0E-91970IPR001005SANT/Myb domain
PfamPF143791.6E-23123170IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MGLQHQSMNL VLSTDAKPRL KWTQELHQRF VEAVNQLGGA DKATPKSLMR VMGIPGLTLY  60
HLKSHLQKYR LGKSQQSLFS IESEQEDDKE IQSSDDHFKE SAVTRSSRGI CSDGNHHPIN  120
ESFQIAQALQ MQMEVQRKLH EQIEVQRHLQ LRIEAQGKYL QTVLKKAQET LAGYNSSSMG  180
IELAKAELCR LVSMVNSGCP SSSISELTET GGSILKDIER TQMRNTVCSM ESSLTSSESS  240
GRKEDMQKEN EIHDTNKSNT AFVELPLMDI HPQENLLDND SSNQGKKRSG SIISDGVSVE  300
QPLARRLKNG DQLRLGTFDL NS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-191673158Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-191673158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-191773157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-191773157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-191773157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-191773157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-191673158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-191673158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-191673158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-191673158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-191673158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-191673158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.008G087600.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU2306110.0CU230611.1 Populus EST from mild drought-stressed leaves.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024461762.10.0myb family transcription factor PHL8
SwissprotF4I2744e-92PHL8_ARATH; Myb family transcription factor PHL8
TrEMBLA0A2K1ZE560.0A0A2K1ZE56_POPTR; Uncharacterized protein
STRINGPOPTR_0010s17510.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.11e-92G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]