PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.008G071700.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 366aa    MW: 40397 Da    PI: 6.9458
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.008G071700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.12.9e-3169122255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         prlrWtp+LH +Fv+ave+LGG+++AtPk +l++m++k+L ++hvkSHLQ+YR+
  Potri.008G071700.1  69 PRLRWTPDLHLCFVHAVERLGGQDRATPKLVLQMMNIKDLNIAHVKSHLQMYRS 122
                         8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.48965125IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.5E-3065124IPR009057Homeodomain-like
SuperFamilySSF466891.72E-1467124IPR009057Homeodomain-like
TIGRFAMsTIGR015575.1E-2269123IPR006447Myb domain, plants
PfamPF002497.2E-870121IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MKGSDSFEGS KSSYSDKKVG QDEGDEEEVD GISFKSKNEG QSTSNSSIEE NKKKAADGSF  60
RQYIRSKMPR LRWTPDLHLC FVHAVERLGG QDRATPKLVL QMMNIKDLNI AHVKSHLQMY  120
RSKRSDDPGQ GQGLLFEGGD NHICNLRQLA MPQDFNQRSP FNLRYGDASW RGHDHMMCRA  180
YMGGTALNRV KHGLYGSVIG CNNHNSLNYG SSVHIPSLNG KATGRTHQSL EAVELFQVSR  240
QNESTPSSME SDFITKLQER SGMLDQVDFL NTSSSADKNW RTIQEMQKGL KRKTLDPDCN  300
LDLNLSLKLA SKDDDELEKC VEGCEVDGSL SLSLSSSSSS KLGGSMEGDG SGKHARMAST  360
LDLTL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-1770124357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-1770124357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-1770124357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-1770124357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.008G071700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024462567.10.0uncharacterized protein LOC7472443
TrEMBLB9HHT80.0B9HHT8_POPTR; Uncharacterized protein
STRINGPOPTR_0008s07170.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23783482
Representative plantOGRP28515123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.13e-49G2-like family protein