PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.008G057400.2
Common NamePOPTR_0008s05750g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 743aa    MW: 82510.7 Da    PI: 5.4033
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.008G057400.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS391.21.2e-1193687391374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l++lL+ cA+av+++d + a+ lL++++++a ++gd+mqRla  f+ +L+arla+s++++y+al +++ts    +++l+a+++f  ++P+ 
  Potri.008G057400.2 368 LRTLLTLCAQAVAADDRRSANDLLKQIRQNAPSTGDAMQRLANIFADGLEARLAGSGTQIYRALISKPTS---AADVLKAYHMFLAACPFR 455
                         5789*************************************************************99999...9***************** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                         k+s++  N++I++ +e+++rvHi+Df+i++G+QWp+L+q L+sRp+gpp+lRiTg++ p++g   +e++eetg+rLa++A++++vpf+fn+
  Potri.008G057400.2 456 KLSNFFSNKTIMNIAENASRVHIVDFGIMYGFQWPCLIQRLSSRPGGPPHLRITGIDLPNPGfrPAERVEETGRRLANYANTFKVPFKFNA 546
                         *************************************************************9***************************** PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                          +a+++e++++e+L+++++E+l+Vn+ ++l +llde+v +es+r+ vL+l+++++P+v++    +  +n++ F +rf eal ++s+lfd l
  Potri.008G057400.2 547 -IAQKWETIKIEDLKIDRNEVLVVNSGYRLRNLLDETVVVESPRNIVLNLIRNMNPDVFIQGVVNGAYNAPFFITRFREALFHFSTLFDVL 636
                         .7***************************************************************************************** PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgW 362
                         ea+++re  er+ +Ere++g+e++nv+acegaer+er et+++W++r+ +aGF+++pl+ ++ ++ak  ++  + + + ++e+s++l++gW
  Potri.008G057400.2 637 EANVSREVPERMLIEREIFGWEAMNVIACEGAERIERPETYKQWQMRVLRAGFRQLPLNREIFTTAKERVEALYHKDFVIDEDSQWLLQGW 727
                         **************************************************************************888************** PP

                GRAS 363 kdrpLvsvSaWr 374
                         k+r ++++S+W+
  Potri.008G057400.2 728 KGRIVYALSSWK 739
                         ***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098569.249342719IPR005202Transcription factor GRAS
PfamPF035144.0E-117368739IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 743 aa     Download sequence    Send to blast
MIMDQSLRGL YGSVNGLKLS NETQSASSVQ DLVNAFKLDN NCVNQNYVNS TRVPPDSTLS  60
NSVLSASMSQ EGDSHEDFDF SDVVLKYISK MLMEEEMEEK TCMFQESSAA LLAAEKSLYE  120
LIGEKHPSAP DDPVQFLDQN HERPDENHDL NCSNCTSSTS SSSGSSLLDH GSTCDLGEYK  180
SSRHASQSSY SPGNSSVTVD GFVDSPVGPN MVAEIFGESE SVMQFKKGFE EASKFIPNGN  240
LLIDLESKGL FLKDLKEDVK DVLATAGEKR ENDNYADGSR GKKNPHPEES ALEGGRSNKQ  300
SAVYSESTAS PADFDMVLLN CGKDDSALQA ALHNGESKSV QQNGQARGSS GGKARGKRQG  360
GKRDVVDLRT LLTLCAQAVA ADDRRSANDL LKQIRQNAPS TGDAMQRLAN IFADGLEARL  420
AGSGTQIYRA LISKPTSAAD VLKAYHMFLA ACPFRKLSNF FSNKTIMNIA ENASRVHIVD  480
FGIMYGFQWP CLIQRLSSRP GGPPHLRITG IDLPNPGFRP AERVEETGRR LANYANTFKV  540
PFKFNAIAQK WETIKIEDLK IDRNEVLVVN SGYRLRNLLD ETVVVESPRN IVLNLIRNMN  600
PDVFIQGVVN GAYNAPFFIT RFREALFHFS TLFDVLEANV SREVPERMLI EREIFGWEAM  660
NVIACEGAER IERPETYKQW QMRVLRAGFR QLPLNREIFT TAKERVEALY HKDFVIDEDS  720
QWLLQGWKGR IVYALSSWKP DC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-463687395375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.10920.0bud
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002311175.20.0hypothetical protein POPTR_0008s05750g
RefseqXP_006379601.10.0hypothetical protein POPTR_0008s05750g
TrEMBLB9HMJ20.0B9HMJ2_POPTR; Uncharacterized protein
STRINGPOPTR_0008s05750.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.10.0GRAS family protein