PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.008G055100.2
Common NamePOPTR_0008s05520g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Dof
Protein Properties Length: 335aa    MW: 35580.9 Da    PI: 9.2882
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.008G055100.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.21.8e-3871130362
              zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                         e+alkcprC+s ntkfCy+nnyslsqPr+fCk+CrryWt GGalrnvPvGgg+r+nk+s+
  Potri.008G055100.2  71 ETALKCPRCQSPNTKFCYFNNYSLSQPRHFCKTCRRYWTSGGALRNVPVGGGCRRNKRSK 130
                         6789*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-2954119IPR003851Zinc finger, Dof-type
PfamPF027012.5E-3273128IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.31174128IPR003851Zinc finger, Dof-type
PROSITE patternPS01361076112IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MVFSSIPAYL GSRNWQQQLN NQPPGAGNEN PQLPPQPAPP PGGGYGDGST GSFRPGSMTD  60
RARLAKVQLP ETALKCPRCQ SPNTKFCYFN NYSLSQPRHF CKTCRRYWTS GGALRNVPVG  120
GGCRRNKRSK GSGRSKFPIK AVSSSSGGLA SNCCTADILG HMPPPPPQLP ILPPLHHLGD  180
YNSADIGLDF GGIQHSIGVT AGGGDGVEFQ IGSSTSSNGV AGSILSSGLV EQWRLQQVQQ  240
QVQQFPFFSN MEPPSGLFSF EGGGIESSNY AGQIRSKPLD TTGITHLATV KTEENQRLNL  300
SKKVLGISGI DQHWGGNNAW TDLPGFTSST SHLL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.008G055100.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002311164.30.0dof zinc finger protein DOF3.6 isoform X2
TrEMBLA0A2K1ZCB10.0A0A2K1ZCB1_POPTR; Uncharacterized protein
STRINGPOPTR_0008s05520.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.21e-46OBF-binding protein 3