PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.008G041500.1
Common NamePOPTR_0008s04110g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family M-type_MADS
Protein Properties Length: 220aa    MW: 24355.2 Da    PI: 9.6031
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.008G041500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF66.52.6e-211764249
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                        +i  ks  qvtfskRr+g++KKA+ELS+LC++++a+i+fs+ +k + +
  Potri.008G041500.1 17 KIAKKSHLQVTFSKRRAGLFKKASELSTLCGVDIAMIVFSPAQKAFSF 64
                        68899999*********************************9997665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.815868IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.62E-26880IPR002100Transcription factor, MADS-box
SMARTSM004327.0E-32867IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-171030IPR002100Transcription factor, MADS-box
PfamPF003195.8E-241764IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-173045IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-174566IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MVNKKPTMGR QKIKIEKIAK KSHLQVTFSK RRAGLFKKAS ELSTLCGVDI AMIVFSPAQK  60
AFSFGHPSVD SMMHRFLTGS PPPPPPSSGL HQLIETRRDA NVHEQNMQLA QILNQLEAEK  120
KNGEVLDQMR KVNRSQCCWE APIEELELHE LEQLRGALEE LKKTVAKQVN NILIQSTSSL  180
PFLAVNGVGE VGNLGTKLEI DNASAALHFN NFAYAQKIC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-16882175Myocyte-specific enhancer factor 2B
1tqe_Q3e-16882175Myocyte-specific enhancer factor 2B
1tqe_R3e-16882175Myocyte-specific enhancer factor 2B
1tqe_S3e-16882175Myocyte-specific enhancer factor 2B
6c9l_A3e-16882175Myocyte-specific enhancer factor 2B
6c9l_B3e-16882175Myocyte-specific enhancer factor 2B
6c9l_C3e-16882175Myocyte-specific enhancer factor 2B
6c9l_D3e-16882175Myocyte-specific enhancer factor 2B
6c9l_E3e-16882175Myocyte-specific enhancer factor 2B
6c9l_F3e-16882175Myocyte-specific enhancer factor 2B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.008G041500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2157330.0AC215733.1 Populus trichocarpa clone POP051-I21, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002311102.11e-162agamous-like MADS-box protein AGL62
TrEMBLB9HLM71e-161B9HLM7_POPTR; Uncharacterized protein
STRINGPOPTR_0008s04110.11e-162(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.11e-44AGAMOUS-like 61