PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.008G038900.3
Common NamePOPTR_0008s03880g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GATA
Protein Properties Length: 355aa    MW: 38941.9 Da    PI: 6.984
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.008G038900.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA551.1e-17258291134
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                         C +C  tkTp+WR gp g+ktLCnaCG++y++ +
  Potri.008G038900.3 258 CMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 291
                         99*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169924.6E-745340IPR016679Transcription factor, GATA, plant
SMARTSM004013.8E-16252302IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.609252288IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.0E-14256289IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577166.65E-15256315No hitNo description
CDDcd002026.41E-14257304No hitNo description
PROSITE patternPS003440258283IPR000679Zinc finger, GATA-type
PfamPF003202.5E-15258291IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MIGQTNTTSN FMDEIDCGSF FEHIDDLLEF PSDDVDATLP DCTTTNNHTS CFMNNDDNSF  60
PGIWSTQSDS LPGSASDLSA ELSVPYEDIV QLEWLSNFVE DSFSGGSLTM KKEESTIVNN  120
KESPPHHQYQ FQTSSPVSVL ESSSSCSGEK TAPRSPEVGA SGKRGRARSK RPRPATFTPR  180
PAMQLISPTS SITEVPQPFV PPKIALDSEN FAESRLVIKI PNHVDPEHKK KKKIKFTVPL  240
GPVEMNQNSS PQQAVRKCMH CEITKTPQWR AGPMGPKTLC NACGVRYKSG RLFPEYRPAA  300
SPTFVPSLHS NSHKKVVEMR AKSGEKITVS RPAAMVANPP ELIPNKSNPA MDYI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1169173KRPRP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.82240.0stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.008G038900.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB9707790.0AB970779.1 Populus nigra PniGATA8b mRNA for GATA type zinc finger domain, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002311088.10.0GATA transcription factor 8
TrEMBLB9HLK60.0B9HLK6_POPTR; GATA transcription factor
STRINGPOPTR_0008s03880.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.27e-44GATA family protein