PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.008G016400.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 206aa    MW: 23034.5 Da    PI: 9.008
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.008G016400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.23.4e-12107152247
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         ++WT+eE+++++ + +++G g+W++I+     ++t+ q+ s+ qky
  Potri.008G016400.1 107 NPWTEEEHKRFLTGLRRFGRGDWRSISINAVITKTPVQVTSHAQKY 152
                         69*****************************889***********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.58E-51559IPR009057Homeodomain-like
PROSITE profilePS500903.9381652IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.605.9E-9100153IPR009057Homeodomain-like
PROSITE profilePS5129415.178101157IPR017930Myb domain
SuperFamilySSF466898.22E-15104158IPR009057Homeodomain-like
SMARTSM007173.7E-9105155IPR001005SANT/Myb domain
TIGRFAMsTIGR015571.7E-15106156IPR006447Myb domain, plants
PfamPF002495.4E-11107152IPR001005SANT/Myb domain
CDDcd001674.33E-8108153No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
SSSFLRSVDS RGGQFEAALV NFPEEFRDRW QRIGAYVGQS AWEVKERYEI LIQDVYEIDS  60
DRIELPRYKD EEAVSWDSGG MVAAAAPSGQ ISCGGKAKQE AEGRKGNPWT EEEHKRFLTG  120
LRRFGRGDWR SISINAVITK TPVQVTSHAQ KYFLRQNSAN NERRGRRRAS TLDITAVDTK  180
TVASSSEDNW IAQPGPPTDR GRAPV*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.008G016400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002316492.27e-77transcription factor SRM1
TrEMBLA0A3N7GQR81e-85A0A3N7GQR8_POPTR; Uncharacterized protein
STRINGPOPTR_0008s01730.11e-140(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Representative plantOGRP27517122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.11e-46MYB family protein