PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.007G135500.1
Common NamePOPTR_0007s01330g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HB-other
Protein Properties Length: 1779aa    MW: 199729 Da    PI: 5.3737
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.007G135500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.42.5e-182783157
                        TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
            Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                        ++kR   +++qle+Le+ +  + yps+++r+eL+ +lgL++rq ++WF+ rR k++k
  Potri.007G135500.1 27 KSKRKMKSASQLEILEKTYSVDTYPSEAARAELSVQLGLSDRQLQMWFCHRRLKDRK 83
                        67999**************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-171383IPR009057Homeodomain-like
SuperFamilySSF466891.54E-152283IPR009057Homeodomain-like
PROSITE profilePS5007116.7142484IPR001356Homeobox domain
SMARTSM003898.4E-162688IPR001356Homeobox domain
CDDcd000861.78E-132783No hitNo description
PfamPF000467.9E-162783IPR001356Homeobox domain
PROSITE profilePS5082717.048555614IPR018501DDT domain
SMARTSM005715.5E-23555614IPR018501DDT domain
PfamPF027911.1E-17556611IPR018501DDT domain
PfamPF050667.5E-15737804IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156121.2E-8952992IPR028942WHIM1 domain
PfamPF156133.3E-1311341206IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1779 aa     Download sequence    Send to blast
MEEAGGGGGV EVEAKKKTPG EGEGESKSKR KMKSASQLEI LEKTYSVDTY PSEAARAELS  60
VQLGLSDRQL QMWFCHRRLK DRKAPLVKRP RKESPSPAGM PGGGEMGVVA EVGNEHGSGS  120
SPFVLGVDPR RAVGRPTGVA VPRISADVQA MKRYYEPQQS IAELRAVAFV EAQLGEPLRE  180
DGPILGMEFD PLPPDAFGAP IATTGQQKQS VRIEANLYER PDVKPIKSTT RTLHEYQFLP  240
QQPTVRAEAY ERAAPSCQYG SPADVHNVKT ESISATLPFM HANKQVSSGY DLSNQVPSLS  300
LMPQESRQGH LLPSTTGEYE TVIQKCSFTN IGMDAQSGAH LVTALDNPYM SSDRRVTHDE  360
DALRMQRKRK SEEARIAREV EAHEKRIRKE LEKQDILRRK REEQMRKEME KHDRERRKEE  420
ERLLREKQRE VERYQREQKR ELERREKFLQ KESIRVEKMR QKEELRREKE AARQKAATER  480
AIARRMAKES MELIDDERLE LMEMAASSKG LPSIIPLDFE TLQNLDLFRD KLTEFPPKSV  540
LLKRPFLIQP WNDSEENVGN LLMVWRFLIT FADVLGIWPF TLDEFVQAFH DYDSRLLSEV  600
HVALLKSIIK DIEDVARTPA TGLGPNQNGA ANPGGGHPQI VEGAYAWGFD LRSWQRHLNP  660
LTWPEILRQF GLSAGFGPQM KKRNVDQAYL RDDNEGNDGE DVITNLRNGA AVENAVSIMQ  720
ERGFSNPRRS RHRLTPGTVK FAAFHVLSLE GSKGLTILEV ADKIQKSGLR DLTTSKTPEA  780
SIAAALSRDS KLFERTAPST YCIRPAYRKD PADTDTILSA ARERIRTFKS GIVDGEDADD  840
AERDEDSESD VAEDHEIDDL GTGLNSKKVA HDSPETNEFN GKTVLGNGKE SGGLKTPQVL  900
LEKVRAGLTS LHSEGTNELK GAGSSIDESV DVAEIHTIPD QDVDIDENNL GEPWVQGLVE  960
GEYSDLSVEE RLNALVALIG VAIEGNSIRV ALEERLEAAN ALKKQMWAEA QLDKRRMKEE  1020
FVTRTQYSSF TGNKMEPNQT ISATEGRQSP MVSVDDRNNG MPVNVSVQQE QLSDQQSDMN  1080
YLNNMPFEGN MQMQDLSAGP DNLTYQQAGH IAEKSRSQLK SVIGHRAEEM YVYRSLPLGQ  1140
DRRRNRYWQF TTSASRNDPG CGRIFVELHD GRWRLIDYEE GFDTLLSSLD VRGVRESHLH  1200
AMLQKIEVPF KETMRRRMLR ANTEGQSKDP IKAEAVEMTA GPESGTGMDS PRSTVCVPDS  1260
DMSETSTSFT IELGRNEIEK NHTLKRFQDF EKWMWKECFK SSVLCAMKYE KKRCTQLLGV  1320
CDYCHDTYFF EDNHCPSCHK THASQTGLNF SEHVAHCERK LKMDPDSALC SLSFPPRIRL  1380
LKSLLALIEV SVLPEALQPV WTNGYRKSWG MKLQSSSCVD DLLQILTLLE IGMKRDYLSS  1440
NYETSSELLS SSDPSGCAAH DSFNTGTAPV LPWLPQTTAA VALRVIEFDA SISYMLHQKL  1500
ESQKDRSAGN FIKLPSKYAV MKYTPDNETT EIPHQAGLLQ EDDWVDVGIG LAGLGREQGI  1560
RGRGRGRTRG GRSQTRIIGS RSESSKRSAS RSSDRLEKVL SWTGRPRGRG GRKSGRRSIR  1620
SRQKAVKKAA EIIPERKIPK KTLYEQSTRR MGRHVRNGDE TRFHTEDAEN ASSSERSEYN  1680
DENENIPASG DEYDDQVVDD YAGGFNGKSD DLLEGSDYNI DSNEEDDDDD AMNEDEDEHG  1740
DSDVEEYINR DSDEDGIRDG GQNGAQDGTE SSSSDFSD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1365370QRKRKS
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Highly expressed in growing tissues such as inflorescence and flower meristems, young leaves and floral organs. Expressed in roots, rosette and cauline leaves, stems, flowers, inflorescences and siliques. {ECO:0000269|PubMed:22694359}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator required for the maintenance of the plant vegetative phase. In association with CHR11 or CHR17 may prevent the early activation of the vegetative-to-reproductive transition by regulating key genes that contribute to flower timing, such as FT, SEP1, SEP3, AGL8/FUL, SOC1 and FLC (PubMed:22694359). Involved in the transcriptional regulation of seed-specific gene expression (PubMed:23872538). {ECO:0000269|PubMed:22694359, ECO:0000269|PubMed:23872538}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.007G135500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2090020.0AC209002.1 Populus trichocarpa clone POP040-E22, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024460587.10.0homeobox-DDT domain protein RLT2 isoform X3
SwissprotQ9FFH10.0RLT2_ARATH; Homeobox-DDT domain protein RLT2
TrEMBLA0A2K1ZTZ30.0A0A2K1ZTZ3_POPTR; Uncharacterized protein
STRINGPOPTR_0007s01330.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25233369
Representative plantOGRP15771634
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.10.0Homeodomain-like transcriptional regulator