PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.007G133400.2
Common NamePOPTR_0007s01530g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Nin-like
Protein Properties Length: 980aa    MW: 107281 Da    PI: 4.9318
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.007G133400.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.85.1e-29589640152
              RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         aek++sl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  Potri.007G133400.2 589 AEKTVSLSVLQQYFSGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKINKV 640
                         5899**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.836574660IPR003035RWP-RK domain
PfamPF020423.5E-26592640IPR003035RWP-RK domain
SuperFamilySSF542774.25E-20877962No hitNo description
SMARTSM006662.2E-20878961IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.2E-23878961No hitNo description
PROSITE profilePS5174520.417878961IPR000270PB1 domain
CDDcd064071.36E-29879960No hitNo description
PfamPF005649.8E-17879960IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 980 aa     Download sequence    Send to blast
MENSFSSKEK GMGYWASPRA QMDSVTTFDG APRNSFFEDP FNSFSELMNF DMYAGWCNNS  60
SAMDQMLAPY GTPSFPSTSY PSFDAGSFAE QNSASIQETI NAAGTSYNGG DKVMLQQTNS  120
HFGCPSDSID ADDLGAKHSN GAGQQNHFPN TTHYIMSQPV GPSLDERMLR ALSLLKVSYG  180
GGILAQVWVP IRSGDQYMLS TSEQPYLLDQ MLAGFREVSR TFTFSAEVKP GVPLGLPGRV  240
FISKVPEWTS NVRYYRKAEY LRAKHAVDHE VRGSFALPIF DPDEMSCCAV LELVTVKEKP  300
DFDSEMENVC HALEVTLCLC LTEIITFQCL SSNKRAALSE IADVLRAVCH AHRLPLALTW  360
MPCNYTEEAV DEIIKVRVKE ANSRSSGKCI LCIEGTACYV NDREMQGFVH ACAEHYIEEG  420
QGIAGKAVQS NHPFFFPDVK TYDITEYPLV HHARKYGLNA AVAIRLRSTY TGDDDYILEL  480
FLPVNIKESS DQQLLLNNLS GTMQRICKSL RTVSDTEFAG QECSEVGLPK EAVPSFQPMS  540
ISNGSSQTAL SEGNLNSAAK MPLNVCSSKN DQIESNSSNE QVEKKRSTAE KTVSLSVLQQ  600
YFSGSLKDAA KSIGVCPTTL KRICRQHGIS RWPSRKINKV NRSLRKIQTV LDSVQGVEGG  660
LKFDPTTGGF VAGGSMNQEF DHRNGFVFQA KNLSNGNSEP ANHDVVSVLP ASCTDGNNST  720
VKVEEDECCI GSGGMLKECS VHVIDCSADS KSVAIDAGLC EQTSFGSGSW ACLEIDPPGS  780
FAKAGNIGGM KNGGIILENS DSRIVPRSSL PFVAAQEMDT KMEGDDGNVE RNQPTCSSMT  840
DSSNSSGSIM HGSISSSPSF EERKHSEEKT SFGDGDLKIT VKARYREDII RFKFDPSAAG  900
CFQLYEEVSK RFKLQTGTFQ LKYLDDEEEW VLLVSDSDLL ECLEIMEYVG TRSVKFLVRD  960
TPFAMGSSDS SSCFLTGRS*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.007G133400.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU2316381e-149CU231638.1 Populus EST from mild drought-stressed leaves.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024461462.10.0protein NLP9
RefseqXP_024461463.10.0protein NLP9
SwissprotO228640.0NLP8_ARATH; Protein NLP8
TrEMBLA0A2K1ZTV00.0A0A2K1ZTV0_POPTR; Uncharacterized protein
STRINGPOPTR_0007s01530.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein
Publications ? help Back to Top
  1. Yan D, et al.
    NIN-like protein 8 is a master regulator of nitrate-promoted seed germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 13179
    [PMID:27731416]