PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.007G133400.1
Common NamePOPTR_0007s01530g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Nin-like
Protein Properties Length: 989aa    MW: 108191 Da    PI: 5.1314
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.007G133400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.85.2e-29598649152
              RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         aek++sl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  Potri.007G133400.1 598 AEKTVSLSVLQQYFSGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKINKV 649
                         5899**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.097581669IPR003035RWP-RK domain
PfamPF020423.6E-26601649IPR003035RWP-RK domain
SuperFamilySSF542774.25E-20886971No hitNo description
PROSITE profilePS5174520.417887970IPR000270PB1 domain
SMARTSM006662.2E-20887970IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.2E-23887970No hitNo description
PfamPF005649.9E-17888969IPR000270PB1 domain
CDDcd064071.12E-29888969No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 989 aa     Download sequence    Send to blast
MENSFSSKEK GMGYWASPRA QMDSVTTFDG APRNSFFEDP FNSFSELMNF DMYAGWCNNS  60
SAMDQMLAPY GTPSFPSTSY PSFDAGSFAE QNSASIQETI NAAGTSYNGG DKVMLQQTNS  120
HFGCPSDSID ADDLGAKHSN GAGQQNHFPN TTHYIMSQPV GPSLDERMLR ALSLLKVSYG  180
GGILAQVWVP IRSGDQYMLS TSEQPYLLDQ MLAGFREVSR TFTFSAEVKP GVPLGLPGRV  240
FISKVPEWTS NVRYYRKAEY LRAKHAVDHE VRGSFALPIF DPDEMSCCAV LELVTVKEKP  300
DFDSEMENVC HALEAVNLRS TAPPRLLPQC LSSNKRAALS EIADVLRAVC HAHRLPLALT  360
WMPCNYTEEA VDEIIKVRVK EANSRSSGKC ILCIEGTACY VNDREMQGFV HACAEHYIEE  420
GQGIAGKAVQ SNHPFFFPDV KTYDITEYPL VHHARKYGLN AAVAIRLRST YTGDDDYILE  480
LFLPVNIKES SDQQLLLNNL SGTMQRICKS LRTVSDTEFA GQECSEVGLP KEAVPSFQPM  540
SISNGSSQTA LSEGNLNSAA KMPLNVCSSK NDQIESNSSN EQTTSGSRRQ VEKKRSTAEK  600
TVSLSVLQQY FSGSLKDAAK SIGVCPTTLK RICRQHGISR WPSRKINKVN RSLRKIQTVL  660
DSVQGVEGGL KFDPTTGGFV AGGSMNQEFD HRNGFVFQAK NLSNGNSEPA NHDVVSVLPA  720
SCTDGNNSTV KVEEDECCIG SGGMLKECSV HVIDCSADSK SVAIDAGLCE QTSFGSGSWA  780
CLEIDPPGSF AKAGNIGGMK NGGIILENSD SRIVPRSSLP FVAAQEMDTK MEGDDGNVER  840
NQPTCSSMTD SSNSSGSIMH GSISSSPSFE ERKHSEEKTS FGDGDLKITV KARYREDIIR  900
FKFDPSAAGC FQLYEEVSKR FKLQTGTFQL KYLDDEEEWV LLVSDSDLLE CLEIMEYVGT  960
RSVKFLVRDT PFAMGSSDSS SCFLTGRS*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.007G133400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU2316381e-167CU231638.1 Populus EST from mild drought-stressed leaves.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024461462.10.0protein NLP9
RefseqXP_024461463.10.0protein NLP9
SwissprotO228640.0NLP8_ARATH; Protein NLP8
TrEMBLA0A2K1ZTV00.0A0A2K1ZTV0_POPTR; Uncharacterized protein
STRINGPOPTR_0007s01530.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34643465
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein
Publications ? help Back to Top
  1. Yan D, et al.
    NIN-like protein 8 is a master regulator of nitrate-promoted seed germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 13179
    [PMID:27731416]