PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.007G129500.1
Common NamePOPTR_0007s01870g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family FAR1
Protein Properties Length: 274aa    MW: 31258.2 Da    PI: 5.9087
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.007G129500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR191.61e-28109196291
                FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                         fYn+YA+++GF +r+sk ++s+r+g+ + r +vC+keg+r ++k++  k  r+raetr+gC+a++ v+k ++gkw+vtk+++eH+H+l+p
  Potri.007G129500.1 109 FYNAYATRIGFVIRVSKLSRSRRDGSAIGRALVCNKEGFRMPDKRE--KIVRQRAETRVGCRAMILVRKISSGKWVVTKFVKEHTHTLTP 196
                         ******************************************9988..9**************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.3E-25109196IPR004330FAR1 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009585Biological Processred, far-red light phototransduction
GO:0010018Biological Processfar-red light signaling pathway
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MSSLIRRRVG MEVIETIDVV FTVDFIVDGD ANGDVPGNAV VDIARAGDEN EIFENSAEEE  60
FEQYEDRKMD KETLDIDTIT DGAPAMSMIT ADEPYLGQEF DSEAAAHAFY NAYATRIGFV  120
IRVSKLSRSR RDGSAIGRAL VCNKEGFRMP DKREKIVRQR AETRVGCRAM ILVRKISSGK  180
WVVTKFVKEH THTLTPGKGR RDCIYEQYPN EHDKIRELSQ QLAIEKKRSA TYKRHLELIF  240
EHIEEHNESL SKKIQHTVDS VRDMENKEQQ SQT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2146280.0AC214628.1 Populus trichocarpa clone POP040-F15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002309799.20.0hypothetical protein POPTR_0007s01870g
TrEMBLB9HH440.0B9HH44_POPTR; Uncharacterized protein
STRINGPOPTR_0007s01870.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP10299610
FabidsOGEF24533072
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59470.26e-89FAR1 family protein