PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.007G129100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family FAR1
Protein Properties Length: 169aa    MW: 19509.6 Da    PI: 8.9783
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.007G129100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR132.43e-105189240
                FAR1  2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegk 40
                        fY+eYA+++GF +r+ + ++s+r+g+i  r++ C+keg+
  Potri.007G129100.1 51 FYDEYARQIGFVMRVMSCRRSERDGRILARRLGCNKEGY 89
                        9************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031014.6E-85189IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MNRCLKVDID EGIEIVESSV GKEMVENVGK DTVVEPHKGM EFESEDAAKV FYDEYARQIG  60
FVMRVMSCRR SERDGRILAR RLGCNKEGYC VSIRGKFGNF EKSGKWVVTK FVKDHNHPLL  120
VAPREARQTM DAKDKKIQEL TAELRNKKRL CATYQEQITA FIKIVEKFL
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.007G129100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2146286e-83AC214628.1 Populus trichocarpa clone POP040-F15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011037100.11e-95PREDICTED: protein FAR1-RELATED SEQUENCE 5
TrEMBLA0A3N7G3V32e-93A0A3N7G3V3_POPTR; Uncharacterized protein
STRINGEOY048692e-89(Theobroma cacao)
STRINGXP_002533360.13e-89(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96531104
Representative plantOGRP3376727
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43280.12e-75FAR1 family protein