PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.007G129000.2
Common NamePOPTR_0007s01920g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family FAR1
Protein Properties Length: 108aa    MW: 12473.5 Da    PI: 10.7575
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.007G129000.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR191.79.7e-2912100290
                FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                         fY+eYAk+ GF +r+ +s+ks+++g+i++r++ C+keg++ +++k+ + + r+r+ +r gC a++ vk+ek gkw+vtk+  eHnH+l+
  Potri.007G129000.2  12 FYDEYAKQEGFLTRIVSSRKSEHDGTIISRRLACNKEGFNLSSQKTGQVKIRKRERKREGCMAMILVKREKLGKWVVTKFTREHNHPLV 100
                         9*********************************************999**************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.5E-2612100IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 108 aa     Download sequence    Send to blast
MVFESENAAR VFYDEYAKQE GFLTRIVSSR KSEHDGTIIS RRLACNKEGF NLSSQKTGQV  60
KIRKRERKRE GCMAMILVKR EKLGKWVVTK FTREHNHPLV ISSKKVD*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in hypocotyls, rosette and cauline leaves, inflorescences stems, flowers and siliques. {ECO:0000269|PubMed:15591448}.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription activator involved in regulating light control of development.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.007G129000.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in hypocotyls by far-red light treatment. {ECO:0000269|PubMed:15591448}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011012934.13e-60PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
SwissprotQ9SZL81e-18FRS5_ARATH; Protein FAR1-RELATED SEQUENCE 5
TrEMBLA0A2K1ZTL27e-73A0A2K1ZTL2_POPTR; Uncharacterized protein
TrEMBLA0A2K1ZTL85e-73A0A2K1ZTL8_POPTR; Uncharacterized protein
TrEMBLA0A3N7FB211e-72A0A3N7FB21_POPTR; Uncharacterized protein
STRINGPOPTR_0007s01920.12e-71(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43280.14e-37FAR1 family protein
Publications ? help Back to Top
  1. Joly-Lopez Z, et al.
    Abiotic Stress Phenotypes Are Associated with Conserved Genes Derived from Transposable Elements.
    Front Plant Sci, 2017. 8: p. 2027
    [PMID:29250089]