PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.007G122800.1
Common NamePOPTR_0007s02510g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 98aa    MW: 11232.4 Da    PI: 4.2071
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.007G122800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.34.6e-104890145
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                        ++ ++++E+ l+ +  ++ G + W++Ia +++ gRt++++  +w 
  Potri.007G122800.1 48 KLEFSEDEETLITRMYNLVGER-WTLIAGRIP-GRTAEEIEKYWT 90
                        678*******************.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.534397IPR017930Myb domain
SMARTSM007174.3E-84795IPR001005SANT/Myb domain
PfamPF002498.9E-94990IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-125091IPR009057Homeodomain-like
CDDcd001671.30E-75089No hitNo description
SuperFamilySSF466891.95E-85093IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 98 aa     Download sequence    Send to blast
MSLQFHTQLP SIDSKDFNFF LLLIMADSDH SSSDDLSVDS RDTSQDSKLE FSEDEETLIT  60
RMYNLVGERW TLIAGRIPGR TAEEIEKYWT SRYSTSQ*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.110818e-94bud
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.007G122800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2134173e-62AC213417.1 Populus trichocarpa clone POP018-J23, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006380310.11e-65MYB-like transcription factor ETC3
TrEMBLU5G9J83e-64U5G9J8_POPTR; MYB-like family protein
STRINGPOPTR_0007s02510.16e-65(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26923178
Representative plantOGRP3921825
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46410.11e-18MYB_related family protein