PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.007G121200.1
Common NamePOPTR_0007s02680g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family CO-like
Protein Properties Length: 333aa    MW: 36378.7 Da    PI: 4.9996
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.007G121200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box16.61.6e-05244339
            zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                        e +C+ ++ +++  +C+ ++  lC  C    H+       H++
  Potri.007G121200.1  2 ESVCDFCGVEKAVVYCKPDSAKLCVHCDGCVHSAnflsrrHRR 44
                        579*****999*****************999955677777776 PP

2CCT644.5e-22276319144
                 CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                         R++a++RY+eK+ktR F+K+irY+sRKa+A++R+RvKGrFvk+ 
  Potri.007G121200.1 276 RDKAKMRYNEKKKTRTFSKQIRYASRKARADTRKRVKGRFVKAG 319
                         899**************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.456147IPR000315B-box-type zinc finger
SMARTSM003364.3E-8147IPR000315B-box-type zinc finger
CDDcd000211.00E-4447No hitNo description
PfamPF062036.7E-17276318IPR010402CCT domain
PROSITE profilePS5101714.694276318IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MESVCDFCGV EKAVVYCKPD SAKLCVHCDG CVHSANFLSR RHRRSLLCDK CSSLPAVARC  60
FDEKLSICQG CDCSANGCSS LGHQLRALNC YTGCYSLAEF SKIWSSVLEG SSSGGFDSGW  120
DSLNSAPINE NCISSCLEQR DNEGDQVSMF PEVTNLPKDI GLPDGEDLCE GLNLDDIPLD  180
FENSDEIFSC SETQSKYQFG DVGKDCMLME KNLSVTGSNG FPAVSGQVHS SMSLPLSNII  240
GESSAADYQD CGLSPLFLTG ESPWESHLDA SSPQARDKAK MRYNEKKKTR TFSKQIRYAS  300
RKARADTRKR VKGRFVKAGE AYDYDPLLSS NF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.007G121200.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2134170.0AC213417.1 Populus trichocarpa clone POP018-J23, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024460898.10.0putative zinc finger protein CONSTANS-LIKE 11
RefseqXP_024460899.10.0putative zinc finger protein CONSTANS-LIKE 11
SwissprotO233791e-101COL11_ARATH; Putative zinc finger protein CONSTANS-LIKE 11
TrEMBLA0A3N7FCZ80.0A0A3N7FCZ8_POPTR; Uncharacterized protein
TrEMBLA0A3N7GRW20.0A0A3N7GRW2_POPTR; Uncharacterized protein
STRINGPOPTR_0007s02680.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70521923
Representative plantOGRP13751334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G15250.11e-102B-box type zinc finger protein with CCT domain