PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.007G120000.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family M-type_MADS
Protein Properties Length: 181aa    MW: 20522.2 Da    PI: 5.7007
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.007G120000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF78.25.7e-25959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        k+i+n s+r++t+skRr gi+KKA ELSvLCd++v +++fs++g+l +++s
  Potri.007G120000.1  9 KKIDNPSRRKITYSKRRDGIIKKATELSVLCDTDVGLLMFSPNGRLTTFAS 59
                        68***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.1E-31160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006626.52161IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.28E-26275IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-21323IPR002100Transcription factor, MADS-box
PfamPF003192.5E-221057IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-212338IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-213859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MGRNKLPMKK IDNPSRRKIT YSKRRDGIIK KATELSVLCD TDVGLLMFSP NGRLTTFASN  60
GRIEDVFLRY FDQSNVLEAG PVEQEGALQE QLDEISQKLQ ERQEKMRSYN PDVVNINSVH  120
DANAHRQFLN DAIQNIEKLQ MEIFHEPIDL QKPGCFQVPP AATRDAHLTA EELVDANGNW  180
*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.007G120000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015881061.21e-62agamous-like MADS-box protein AGL104
RefseqXP_024461066.13e-63uncharacterized protein LOC7486050
RefseqXP_024461067.13e-63uncharacterized protein LOC7486050
TrEMBLA0A3N7FE737e-62A0A3N7FE73_POPTR; Uncharacterized protein
STRINGEOX991896e-48(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1753967
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22130.15e-27AGAMOUS-like 104