PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.007G119000.1
Common NamePOPTR_0007s02880g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 450aa    MW: 50082.8 Da    PI: 4.9856
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.007G119000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS283.46.5e-87454422373
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         ++lLl+cA a++++d +laq++++ l++ as  gdp+qRl++ f++AL +r ++ +++ ++   +s+ +++n+s +     +++++ P+++
  Potri.007G119000.1  45 EKLLLHCASALEHNDGTLAQQVMWVLNNVASLVGDPNQRLTSWFLRALISRASKVCPTAMNFDGSSTIRRRNMSVTEL--AVYVDLIPWHR 133
                         689***************************************************999999877777777666554433..469******** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvpfefnv 180
                         f++ + N+aIl+a+eg ++vHi+Df+i++++QWp+L++aLa RpegppslRiT+ +   ++    + + ee+g rL++fA+  +vpfefnv
  Potri.007G119000.1 134 FGFCASNSAILKAIEGYSKVHILDFSITHCMQWPTLIDALAIRPEGPPSLRITVPSCRPPVppfLNVSCEEVGLRLSNFAKYRDVPFEFNV 224
                         *****************************************************97775555668999************************ PP

                GRAS 181 l......................vakrledleleeLrvkpgEalaVnlvlqlhrllde....svsleserdevLklvkslsPkvvvvveqe 245
                         +                       ++ l+ l++ +L+++ +Eal++n++  l +l de    sv+ +s rd++L +vk+ +P +vvvv+++
  Potri.007G119000.1 225 FdhdpssfasseimsqesshdfhFESLLNHLTPAMLDLRDDEALVINCQNWLRYLSDEekgnSVQDSSLRDAFLCTVKGFNPCIVVVVDED 315
                         ************999888877755557788899999*******************98722214455569********************** PP

                GRAS 246 adhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakq 336
                         +d++++s+  r++ ++++ +  fd+le+ l ++s++ri +E   +g +i+n+++ ega+r+er e+  k  +r+++aGF++vp+ e++  +
  Potri.007G119000.1 316 SDLSAPSLSSRITTCFNFLWIPFDALETFLLKDSSQRIEYESD-IGHKIENIISFEGAQRIERLESGIKLAQRMKNAGFSSVPFCEDTIGE 405
                         *******************************************.*********************************************** PP

                GRAS 337 aklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaW 373
                         +++ll++++ ++g++  ee++ lvl+Wk+++ v+ +aW
  Potri.007G119000.1 406 VRSLLEEHAgGWGMKR-EEDHMLVLTWKGHNSVFSTAW 442
                         *********6776654.5678999************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.51318423IPR005202Transcription factor GRAS
PfamPF035142.2E-8445442IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 450 aa     Download sequence    Send to blast
MKTELRGNSN TSISLQNPSL FNNPQSSVSG ALNGCLGSLD GACIEKLLLH CASALEHNDG  60
TLAQQVMWVL NNVASLVGDP NQRLTSWFLR ALISRASKVC PTAMNFDGSS TIRRRNMSVT  120
ELAVYVDLIP WHRFGFCASN SAILKAIEGY SKVHILDFSI THCMQWPTLI DALAIRPEGP  180
PSLRITVPSC RPPVPPFLNV SCEEVGLRLS NFAKYRDVPF EFNVFDHDPS SFASSEIMSQ  240
ESSHDFHFES LLNHLTPAML DLRDDEALVI NCQNWLRYLS DEEKGNSVQD SSLRDAFLCT  300
VKGFNPCIVV VVDEDSDLSA PSLSSRITTC FNFLWIPFDA LETFLLKDSS QRIEYESDIG  360
HKIENIISFE GAQRIERLES GIKLAQRMKN AGFSSVPFCE DTIGEVRSLL EEHAGGWGMK  420
REEDHMLVLT WKGHNSVFST AWVPNGLQE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-25424422374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002309852.20.0hypothetical protein POPTR_0007s02880g
TrEMBLB9HE600.0B9HE60_POPTR; Uncharacterized protein
STRINGPOPTR_0007s02880.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP24991534
FabidsOGEF100743142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-126GRAS family protein