PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.007G113800.1
Common NamePOPTR_0007s03430g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family M-type_MADS
Protein Properties Length: 247aa    MW: 27177 Da    PI: 10.372
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.007G113800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF69.43.3e-221562249
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                        +i n+sn  vtfskRr g++KKA+E+S+LC+aeva+i+fs+  k++ +
  Potri.007G113800.1 15 KIANESNLMVTFSKRRSGLFKKASEISTLCGAEVAIIVFSPGKKVFSF 62
                        589**************************************9999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.2E-30665IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.857666IPR002100Transcription factor, MADS-box
CDDcd002653.88E-34774No hitNo description
SuperFamilySSF554551.96E-26778IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-18828IPR002100Transcription factor, MADS-box
PfamPF003191.4E-241562IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-182843IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-184364IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MVRSSKGRQK LEMVKIANES NLMVTFSKRR SGLFKKASEI STLCGAEVAI IVFSPGKKVF  60
SFGHPSVEKV VERYVSGNIP QTSGAFHLIE AHRKARISEL NMKLTQAQNQ LEMEKKRGEE  120
LDKLRRASQS QNWWDSPLQE LSVAQLEQLK ASLLTLKQNL AMQAQQILLQ NSAPPQPFFS  180
PNPGAAGNLP FDTINTGFNS NMAVAPFSSN TTMTAFNANM TGTPFNQSST TMTPYGYNLG  240
YGNGFF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A4e-17783177Myocyte-specific enhancer factor 2A
3kov_B4e-17783177Myocyte-specific enhancer factor 2A
3kov_I4e-17783177Myocyte-specific enhancer factor 2A
3kov_J4e-17783177Myocyte-specific enhancer factor 2A
3p57_A4e-17783177Myocyte-specific enhancer factor 2A
3p57_B4e-17783177Myocyte-specific enhancer factor 2A
3p57_C4e-17783177Myocyte-specific enhancer factor 2A
3p57_D4e-17783177Myocyte-specific enhancer factor 2A
3p57_I4e-17783177Myocyte-specific enhancer factor 2A
3p57_J4e-17783177Myocyte-specific enhancer factor 2A
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.007G113800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024460670.10.0agamous-like MADS-box protein AGL62
TrEMBLA0A2K1ZSV20.0A0A2K1ZSV2_POPTR; Uncharacterized protein
STRINGPOPTR_0007s03430.11e-177(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-61AGAMOUS-like 62