PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.007G097100.1
Common NamePOPTR_0007s05010g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 329aa    MW: 36845.6 Da    PI: 4.583
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.007G097100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.94e-1960113356
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         k+++++ +q+++Le+ Fe ++++  e++ +LA++lgL+ rqV vWFqNrRa++k
  Potri.007G097100.1  60 KKRRLSGDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWK 113
                         566899***********************************************9 PP

2HD-ZIP_I/II131.53.3e-4259151193
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekkrrls +qvk+LE++Fe e+kLeperKv+la+eLglqprqvavWFqnrRAR+ktkqlE+dy +Lk++yd+lk++ ++L++++e+L +e+
  Potri.007G097100.1  59 EKKRRLSGDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLERDYGVLKANYDSLKHNFDALQHDNEALLKEI 149
                         69*************************************************************************************9999 PP

         HD-ZIP_I/II  92 ke 93 
                         +e
  Potri.007G097100.1 150 RE 151
                         86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.5E-1947117IPR009057Homeodomain-like
PROSITE profilePS5007117.49155115IPR001356Homeobox domain
SMARTSM003897.4E-1858119IPR001356Homeobox domain
PfamPF000462.2E-1660113IPR001356Homeobox domain
CDDcd000861.25E-1660116No hitNo description
Gene3DG3DSA:1.10.10.603.0E-2062122IPR009057Homeodomain-like
PRINTSPR000319.5E-68695IPR000047Helix-turn-helix motif
PROSITE patternPS00027090113IPR017970Homeobox, conserved site
PRINTSPR000319.5E-695111IPR000047Helix-turn-helix motif
PfamPF021833.6E-19115156IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MKRSLGSSDS LGALMSICPS AEEHSPRNHT HVYSREFQSM LDGLDEEGCV EEAGGHVTEK  60
KRRLSGDQVK ALEKNFEVEN KLEPERKVKL AQELGLQPRQ VAVWFQNRRA RWKTKQLERD  120
YGVLKANYDS LKHNFDALQH DNEALLKEIR ELKAKLNEEN AESNVSVKEE IILAESEDKM  180
PEEDTPALLD SVAASETKEL NYETFNNHSS INIGLGASLF PDFKDGSSDS DSSAILNEDN  240
SPNPAISSSG ILQSQLMMSP PPSSSLRFNC SASSSSPSSM NCFQFSKSYQ TQFVKLEEHN  300
FFSSEEACNF FSDEQPPSLP WYSSDQWN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1107115RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.95920.0bud| leaf
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:10527431, ECO:0000269|PubMed:16055682}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that may act as growth regulators in response to water deficit. Interacts with the core sequence 5'-CAATTATTA-3' of promoters in response to ABA and in an ABI1-dependent manner. Involved in the negative regulation of the ABA signaling pathway. {ECO:0000269|PubMed:10527431, ECO:0000269|PubMed:12065416}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.007G097100.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By water deficit, by abscisic acid (ABA) and by salt stress. Self expression regulation. {ECO:0000269|PubMed:10527431, ECO:0000269|PubMed:12065416, ECO:0000269|PubMed:16055682}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1479450.0EF147945.1 Populus trichocarpa clone WS0126_C14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006380403.10.0homeobox-leucine zipper protein ATHB-6
SwissprotP466682e-81ATHB6_ARATH; Homeobox-leucine zipper protein ATHB-6
TrEMBLA9PHT90.0A9PHT9_POPTR; HD-ZIP family protein
STRINGPOPTR_0007s05010.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18683489
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22430.14e-82homeobox protein 6
Publications ? help Back to Top
  1. Ralph SG, et al.
    Analysis of 4,664 high-quality sequence-finished poplar full-length cDNA clones and their utility for the discovery of genes responding to insect feeding.
    BMC Genomics, 2008. 9: p. 57
    [PMID:18230180]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]