PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.007G093400.3
Common NamePOPTR_0007s05410g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family CAMTA
Protein Properties Length: 1021aa    MW: 115041 Da    PI: 6.1005
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.007G093400.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1179.34.6e-56201362118
                CG-1   2 lkekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenp 92 
                         l+ ++rwl++ ei++iL+n+++++++ e+++ p+sgsl+L++rk++ryfrkDG++w+kkkdgktv+E+he+LK g+v+vl+cyYah+e+n+
  Potri.007G093400.3  20 LEAQHRWLRPAEICEILTNYQRFRIAPEPAHMPPSGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKSGSVDVLHCYYAHGEDNE 110
                         5679*************************************************************************************** PP

                CG-1  93 tfqrrcywlLeeelekivlvhylevk 118
                         +fqrr+ywlLeeel++ivlvhy+evk
  Potri.007G093400.3 111 NFQRRSYWLLEEELSHIVLVHYREVK 136
                         ***********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143782.04115141IPR005559CG-1 DNA-binding domain
SMARTSM010768.2E-7718136IPR005559CG-1 DNA-binding domain
PfamPF038595.1E-4921134IPR005559CG-1 DNA-binding domain
Gene3DG3DSA:2.60.40.101.9E-4478566IPR013783Immunoglobulin-like fold
SuperFamilySSF812969.49E-16480565IPR014756Immunoglobulin E-set
PfamPF018331.9E-5480563IPR002909IPT domain
SuperFamilySSF484034.2E-15655771IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.204.1E-16660772IPR020683Ankyrin repeat-containing domain
CDDcd002046.16E-11666769No hitNo description
PROSITE profilePS5029716.547677781IPR020683Ankyrin repeat-containing domain
PfamPF000235.0E-4710741IPR002110Ankyrin repeat
SMARTSM002480.011710739IPR002110Ankyrin repeat
PROSITE profilePS500889.778710742IPR002110Ankyrin repeat
SMARTSM002483300749778IPR002110Ankyrin repeat
SuperFamilySSF525404.78E-8863917IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM000152866888IPR000048IQ motif, EF-hand binding site
PfamPF006120.0042869887IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500968.206869896IPR000048IQ motif, EF-hand binding site
SMARTSM000150.0039889911IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500969.597890914IPR000048IQ motif, EF-hand binding site
PfamPF006122.1E-4892911IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0010150Biological Processleaf senescence
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005516Molecular Functioncalmodulin binding
Sequence ? help Back to Top
Protein Sequence    Length: 1021 aa     Download sequence    Send to blast
MADTKRYPLG NQLDIQQILL EAQHRWLRPA EICEILTNYQ RFRIAPEPAH MPPSGSLFLF  60
DRKVLRYFRK DGHNWRKKKD GKTVKEAHER LKSGSVDVLH CYYAHGEDNE NFQRRSYWLL  120
EEELSHIVLV HYREVKGTRT NFNRIKEHEE CIPYSQETED TMPSSEMDTS VSSRFHPNGY  180
QVPTRTTDTT SMNSAQASEY EDAESVYNNQ ASSTFHSFLE VQKPAMERID TGSSVHYDHM  240
TFSSDYQGKL SAVPGMDVIS LAQVDKTKET NGTESACEPQ KVIDLPSWED VLENYARGTE  300
SVPFQTLLSQ DDTVGIIPKQ EDGILEKLLT NSFDKREDIG RYDLTARFPD QQLDSGNLIN  360
TLEPLCTQEN DLHIQNDIQI QPANADHGMT LEGKSMYSSS VKHHILDGSG TEGLKKLDSF  420
TRWMSKELGD VEPQVQSSSG SYWITAESEN GVDDSSNPSQ GNLDAYLLSP SLSQDQLFSI  480
IDFSPNWAYA GTEIKVLIMG RFLKGREAAE NCQWSIMFGE VEVPAEVIAD GVLRCNTPSH  540
KAGRIPFYVT CSNRVACSEV REFEYLSHTQ DITYYYSDSV TEDLNMRFGK LLSLSSVSPS  600
KYDSSSVDEI LSSKINSLLN EDNETWDQMF KLTSEEGFSS EKVKEQLVQK LLKEQLHVWL  660
LQKASEGGKG PSVLDEGGQG VLHFAAALGY DWALEPTIVA GVSVNFRDVN GWTALHWAAS  720
YGRERTVASL IHLGAAPGAL TDPTPKYPTS RTPADLASAN GHKGISGFLA ESALSAHLSS  780
LNLEKQDGKA AEFNDADLPS RLPLKDSLAA VCNATQAAAR IHQVFRVQSF QKKQLKEYGD  840
DKLGMSHERA LSLIAVKSQK AGQYDEPVHA AIRIQNKFRG WKGRKEFLII RQRIVKIQAH  900
VRGHQVRKNY RKIIWSVGIL DKIILRWRRK GSGLRGFKSE ALTDGSSMQV VQSKDDDDDF  960
LKEGRRQTEE RSQIALARVK SMHQHPEARE QYCRLRNVVA EIQEAKVTDY YFYSFSLLVA  1020
*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves, carpels, and siliques, but not in stigmas or other parts of the flower. {ECO:0000269|PubMed:11162426, ECO:0000269|PubMed:12218065, ECO:0000269|PubMed:14581622}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3'. Binds calmodulin in a calcium-dependent manner in vitro (PubMed:12218065). Regulates transcriptional activity in response to calcium signals (Probable). Involved in freezing tolerance in association with CAMTA1 and CAMTA2 (PubMed:23581962). Required for the cold-induced expression of DREB1B/CBF1, DREB1C/CBF2, ZAT12 and GOLS3 (PubMed:19270186). Involved in response to cold. Contributes together with CAMTA5 to the positive regulation of the cold-induced expression of DREB1A/CBF3, DREB1B/CBF1 and DREB1C/CBF2 (PubMed:28351986). Involved together with CAMTA2 and CAMTA4 in the positive regulation of a general stress response (GSR) (PubMed:25039701). Involved in the regulation of GSR amplitude downstream of MEKK1 (PubMed:25157030). Involved in the regulation of a set of genes involved in defense responses against pathogens (PubMed:18298954). Involved in the regulation of both basal resistance and systemic acquired resistance (SAR) (PubMed:21900483). Acts as negative regulator of plant immunity (PubMed:19122675, PubMed:21900483, PubMed:22345509, PubMed:28407487). Binds to the promoter of the defense-related gene EDS1 and represses its expression (PubMed:19122675). Binds to the promoter of the defense-related gene NDR1 and represses its expression (PubMed:22345509). Involved in defense against insects (PubMed:23072934, PubMed:22371088). Required for tolerance to the generalist herbivore Trichoplusia ni, and contributes to the positive regulation of genes associated with glucosinolate metabolism (PubMed:23072934). Required for tolerance to Bradysia impatiens larvae. Mediates herbivore-induced wound response (PubMed:22371088). Required for wound-induced jasmonate accumulation (PubMed:23072934, PubMed:22371088). Involved in the regulation of ethylene-induced senescence by binding to the promoter of the senescence-inducer gene EIN3 and repressing its expression (PubMed:22345509). {ECO:0000269|PubMed:12218065, ECO:0000269|PubMed:18298954, ECO:0000269|PubMed:19122675, ECO:0000269|PubMed:19270186, ECO:0000269|PubMed:21900483, ECO:0000269|PubMed:22345509, ECO:0000269|PubMed:22371088, ECO:0000269|PubMed:23072934, ECO:0000269|PubMed:23581962, ECO:0000269|PubMed:25039701, ECO:0000269|PubMed:25157030, ECO:0000269|PubMed:28351986, ECO:0000269|PubMed:28407487, ECO:0000305|PubMed:11925432}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00042PBMTransfer from AT2G22300Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.007G093400.3
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By heat shock, UVB, salt, wounding, ethylene and methyl jasmonate (PubMed:11162426, PubMed:12218065). Induced by infection with the fungal pathogen Golovinomyces cichoracearum (powdery mildew) and the bacterial pathogen Pseudomonas syringae pv tomato strain DC3000 (PubMed:22345509). {ECO:0000269|PubMed:11162426, ECO:0000269|PubMed:12218065, ECO:0000269|PubMed:22345509}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024461052.10.0calmodulin-binding transcription activator 3 isoform X2
SwissprotQ8GSA70.0CMTA3_ARATH; Calmodulin-binding transcription activator 3
TrEMBLA0A2K1ZRQ80.0A0A2K1ZRQ8_POPTR; Uncharacterized protein
STRINGPOPTR_0007s05410.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22300.20.0signal responsive 1
Publications ? help Back to Top
  1. Zhang L,Du L,Shen C,Yang Y,Poovaiah BW
    Regulation of plant immunity through ubiquitin-mediated modulation of Ca(2+) -calmodulin-AtSR1/CAMTA3 signaling.
    Plant J., 2014. 78(2): p. 269-81
    [PMID:24528504]
  2. Benn G, et al.
    A key general stress response motif is regulated non-uniformly by CAMTA transcription factors.
    Plant J., 2014. 80(1): p. 82-92
    [PMID:25039701]
  3. Rahman H,Yang J,Xu YP,Munyampundu JP,Cai XZ
    Phylogeny of Plant CAMTAs and Role of AtCAMTAs in Nonhost Resistance to Xanthomonas oryzae pv. oryzae.
    Front Plant Sci, 2016. 7: p. 177
    [PMID:26973658]
  4. Benn G, et al.
    Plastidial metabolite MEcPP induces a transcriptionally centered stress-response hub via the transcription factor CAMTA3.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(31): p. 8855-60
    [PMID:27432993]
  5. Kidokoro S, et al.
    Different Cold-Signaling Pathways Function in the Responses to Rapid and Gradual Decreases in Temperature.
    Plant Cell, 2017. 29(4): p. 760-774
    [PMID:28351986]
  6. Lolle S, et al.
    Matching NLR Immune Receptors to Autoimmunity in camta3 Mutants Using Antimorphic NLR Alleles.
    Cell Host Microbe, 2017. 21(4): p. 518-529.e4
    [PMID:28407487]
  7. Kim YS, et al.
    CAMTA-Mediated Regulation of Salicylic Acid Immunity Pathway Genes in Arabidopsis Exposed to Low Temperature and Pathogen Infection.
    Plant Cell, 2017. 29(10): p. 2465-2477
    [PMID:28982964]
  8. Jacob F, et al.
    A dominant-interfering camta3 mutation compromises primary transcriptional outputs mediated by both cell surface and intracellular immune receptors in Arabidopsis thaliana.
    New Phytol., 2018. 217(4): p. 1667-1680
    [PMID:29226970]