PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.007G087500.1
Common NamePOPTR_0007s05980g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family M-type_MADS
Protein Properties Length: 354aa    MW: 39971 Da    PI: 4.9919
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.007G087500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF84.66.1e-27958150
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                        krien++nrqvtfskRrng++KKA+EL +LCd+++a+i+fs++g+l  +s
  Potri.007G087500.1  9 KRIENNTNRQVTFSKRRNGLIKKAYELAILCDIDIALIMFSPSGRLSHFS 58
                        79********************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.2E-37160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.506161IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.62E-29279IPR002100Transcription factor, MADS-box
CDDcd002653.44E-35279No hitNo description
PRINTSPR004041.4E-25323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.8E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-253859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MGRVKLQIKR IENNTNRQVT FSKRRNGLIK KAYELAILCD IDIALIMFSP SGRLSHFSGK  60
RRLEDVIARY INMSEHDRDF SCGIQNREYL LNILRKLKTE NDMALQAAKQ DSLSQFNFNQ  120
FIEIQLEARN LQHQLYMAEE QLRLYEPDPL KITSMMELES CEKTLLDTMA RLEERKKCIL  180
SNPAVSTYDP SSMQMFLDTN GGMPDFENDI VSWLPENGNN PSSVRVGSDQ SSCVPVSNQS  240
SMTLFDALSH VTNNVNANHC NNMEGSNINN SNSEVFPSWY QAFSTLSSTE LLSAFMPPTS  300
FSAVKQENIA GPSFTSMLQQ PQAETTSNCL QMPSSTADQC SDYENQIKQS KVE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A3e-17175174MEF2 CHIMERA
6byy_B3e-17175174MEF2 CHIMERA
6byy_C3e-17175174MEF2 CHIMERA
6byy_D3e-17175174MEF2 CHIMERA
6bz1_A3e-17175174MEF2 CHIMERA
6bz1_B3e-17175174MEF2 CHIMERA
6bz1_C3e-17175174MEF2 CHIMERA
6bz1_D3e-17175174MEF2 CHIMERA
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.007G087500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024460612.10.0agamous-like MADS-box protein AGL104 isoform X1
TrEMBLA0A2K1ZRF50.0A0A2K1ZRF5_POPTR; Uncharacterized protein
STRINGPOPTR_0007s05980.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85252735
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22130.16e-69AGAMOUS-like 104