PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.007G058200.1
Common NamePOPTR_0007s09520g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Dof
Protein Properties Length: 345aa    MW: 37080.9 Da    PI: 8.0908
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.007G058200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.66.6e-393292262
              zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                        +e+alkcprC+s ntkfCyynnysl+qPr+fCk+CrryWtkGGalr vP+Ggg+rknkk +
  Potri.007G058200.1 32 QEQALKCPRCESPNTKFCYYNNYSLTQPRHFCKTCRRYWTKGGALRSVPIGGGCRKNKKIK 92
                        5799******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-243386IPR003851Zinc finger, Dof-type
PfamPF027017.5E-333490IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.9843690IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103874IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MVPPDNLQEK QTSKEDNQSS SSSRKTATTR PQEQALKCPR CESPNTKFCY YNNYSLTQPR  60
HFCKTCRRYW TKGGALRSVP IGGGCRKNKK IKSSSRLSSD SKDSSGSSEI AGFSFFHGLS  120
PAVDFNLGGL SFPRLNPSQN GLYNHFPSFG DISATSAAAA TVTSPSFTLD PSVSSTGSCS  180
LMGFNYPLTS VASGFCGAIQ ENIGGASMNI NTNLPSSIES LSCINQDLHW KLQQQRLAML  240
FGTGENHKDG STVSTDPIEN QVQKPQPIMF ENLEISKPQV CAAGNSRKEG AASGDTATEW  300
FFGNSYSQVT ATPTNTSNNG NNDNTGNWNG VQAWGDLHQY SALP*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.007G058200.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006380583.20.0dof zinc finger protein DOF5.7
TrEMBLA0A2K1ZPY20.0A0A2K1ZPY2_POPTR; Uncharacterized protein
STRINGPOPTR_0005s19310.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38543460
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.15e-60Dof family protein