PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.007G053500.1
Common NamePOPTR_0007s10030g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 453aa    MW: 50769.1 Da    PI: 5.4113
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.007G053500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS295.91e-90494492373
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn...sseelaalkl..fsev 87 
                         ++lL++c++a++s+d++l q++L+ l+++a pdgd++qRl+  f++AL ar a+  s+++k l++ e+++ n    ++++++ +l  f+++
  Potri.007G053500.1  49 EQLLVHCVNAIESNDATLSQQILWVLNNIAPPDGDSNQRLTCAFLRALIARAAK--SGTCKLLAAMENAHCNlaiDTHKFSIIELasFVDL 137
                         79****************************************************..8888888887777777554233333333366**** PP

                GRAS  88 sPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvp 175
                         +P+++f++ +aN aIleaveg   +Hi+D+++++++Q p+L +a+a+R e pp +++T+ g+ e +      ++ee+g++L +fA++ ++ 
  Potri.007G053500.1 138 TPWHRFGYTAANAAILEAVEGYLVIHIVDLSLTHCMQIPTLVDAIANRFEVPPLIKLTVAGATEDVpplLDLSYEELGSKLVNFARSRNII 228
                         **************************************************************88879988999****************** PP

                GRAS 176 fefnvl.......vakrledleleeLrvkp.gEalaVnlvlqlhrll.................desvsleserdevLklvkslsPkvvvv 241
                         +ef+v+        ++ +e+l++++L   + gEal++n++++lh+++                 ++s s+ s r+ +Lk ++sl P++vv+
  Potri.007G053500.1 229 MEFRVIpssyadgFSSFIEQLRVQHLVYAEsGEALVINCHMMLHYIPeetlsgipstnsntysyESSSSSMSFRTMFLKSLRSLDPTLVVL 319
                         ******8885554445555556666655559********************************9777777778****************** PP

                GRAS 242 veqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsek 332
                         v+++ad++s++++ r+ +a++y +  +d++++ lpr s++r+++E+  + ++i+nv+a+eg +r+er e + +W +r+++a F+ +++ ++
  Potri.007G053500.1 320 VDEDADLTSNNLVCRLRSAFNYLWIPYDTVDTFLPRGSRQRQWYEAD-ICWKIENVIAHEGPQRVERLEPKCRWIQRMRNANFRGISFADD 409
                         ***********************************************.******************************************* PP

                GRAS 333 aakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                         a +++k++l +++  g+ +++e++ +vl+Wk++++v++SaW
  Potri.007G053500.1 410 AISEVKTMLDEHA-AGWGLKKEDDDIVLTWKGHNVVFASAW 449
                         *************.999************************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098542.25622431IPR005202Transcription factor GRAS
PfamPF035143.5E-8849449IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 453 aa     Download sequence    Send to blast
MMQFTETPLP TLHQIITPIS NPTMNRNRPW PGFPTSKSLG SFGDANCMEQ LLVHCVNAIE  60
SNDATLSQQI LWVLNNIAPP DGDSNQRLTC AFLRALIARA AKSGTCKLLA AMENAHCNLA  120
IDTHKFSIIE LASFVDLTPW HRFGYTAANA AILEAVEGYL VIHIVDLSLT HCMQIPTLVD  180
AIANRFEVPP LIKLTVAGAT EDVPPLLDLS YEELGSKLVN FARSRNIIME FRVIPSSYAD  240
GFSSFIEQLR VQHLVYAESG EALVINCHMM LHYIPEETLS GIPSTNSNTY SYESSSSSMS  300
FRTMFLKSLR SLDPTLVVLV DEDADLTSNN LVCRLRSAFN YLWIPYDTVD TFLPRGSRQR  360
QWYEADICWK IENVIAHEGP QRVERLEPKC RWIQRMRNAN FRGISFADDA ISEVKTMLDE  420
HAAGWGLKKE DDDIVLTWKG HNVVFASAWL PA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B6e-474345182474Protein SHORT-ROOT
5b3h_B2e-474345128420Protein SHORT-ROOT
5b3h_E2e-474345128420Protein SHORT-ROOT
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, leaves and flowers. {ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.007G053500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006380635.20.0scarecrow-like protein 32 isoform X1
SwissprotQ9SN220.0SCL32_ARATH; Scarecrow-like protein 32
TrEMBLA0A2K1ZPQ70.0A0A2K1ZPQ7_POPTR; Uncharacterized protein
STRINGPOPTR_0007s10030.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77023347
Representative plantOGRP24991534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.10.0GRAS family protein