PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.007G039400.2
Common NamePOPTR_0007s11470g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 290aa    MW: 32964.3 Da    PI: 7.3185
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.007G039400.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.19.9e-29219269151
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                         k+r++W+peLH+rFv+a++qLGG ++AtPk+i+e+m+v+gLt+++vkSHLQ
  Potri.007G039400.2 219 KQRRCWSPELHRRFVDALQQLGGCQVATPKQIREHMQVDGLTNDEVKSHLQ 269
                         79************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.467216276IPR017930Myb domain
SuperFamilySSF466891.16E-14217273IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.7E-24218269IPR009057Homeodomain-like
TIGRFAMsTIGR015575.7E-24219273IPR006447Myb domain, plants
PfamPF002492.0E-7221269IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010092Biological Processspecification of organ identity
GO:0010629Biological Processnegative regulation of gene expression
GO:0048449Biological Processfloral organ formation
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MELSLDLSLV CEPKTINECL KEVSMVKDGS QKLTKLYDYV ERLEDERRKI DAFKRELPLC  60
MLLLNEAIAR LKEEAMQCSE LNDLIPLKGN SNEDGNDKKN WMSSVQLWNT NNHLDCKKQD  120
SKSEPKQKSE EDDDRSTCEN PVQLGDHSNK GEAFVPFKAL SGFEGSKRKE EKEVVSQVTG  180
LSPMTPVPDL SSCNWTRKSN NCSNQTKILS KSQQQAYRKQ RRCWSPELHR RFVDALQQLG  240
GCQVATPKQI REHMQVDGLT NDEVKSHLQV SFIPSSPSIS RSMQGPFNR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.35350.0bud
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00629PBMTransfer from PK14402.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.007G039400.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2165990.0AC216599.1 Populus trichocarpa clone POP051-K05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002310743.10.0transcription factor HHO5
TrEMBLB9HE750.0B9HE75_POPTR; Uncharacterized protein
STRINGPOPTR_0007s11470.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.14e-63G2-like family protein