PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.007G038100.1
Common NamePOPTR_0007s11620g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Dof
Protein Properties Length: 324aa    MW: 34169 Da    PI: 8.8379
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.007G038100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1252.3e-3962121362
              zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                         +++l+cprCds+ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rknk++s
  Potri.007G038100.1  62 QENLRCPRCDSSNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKNTS 121
                         7889*****************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2562118IPR003851Zinc finger, Dof-type
PfamPF027011.1E-3263119IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.54465119IPR003851Zinc finger, Dof-type
PROSITE patternPS01361067103IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MIQELLGGAG LIGGERKIPI NATILEGTPS PSPSLSPSPS PSSSTTSAAT TSATNSTPSS  60
AQENLRCPRC DSSNTKFCYY NNYNLTQPRH FCKTCRRYWT KGGALRNVPI GGGCRKNKNT  120
SVSASVGKSG TNKMKTMASD IGRSGFGNGF EHELSSSPIM WASPQNSHIL ALLRATQNPN  180
PSTLSNSIFV KEEGGLIGNQ FISEPGVGTA ALNARTLGLD PISQVPSLGL CSPFWKSNQH  240
QQNGFTVGEA QNSGIQELYQ RLRSSTNYYT DNPSAIVLSN VATSSSTSTS TILESAPVAG  300
GELGYWNPAF SWSDLPTTNG AYP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.131230.0stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.007G038100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1447490.0EF144749.1 Populus trichocarpa clone WS01117_M16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002310753.10.0dof zinc finger protein DOF1.1 isoform X1
TrEMBLA9P9B50.0A9P9B5_POPTR; Uncharacterized protein
STRINGPOPTR_0007s11620.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72193247
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.14e-34TARGET OF MONOPTEROS 6
Publications ? help Back to Top
  1. Ralph SG, et al.
    Analysis of 4,664 high-quality sequence-finished poplar full-length cDNA clones and their utility for the discovery of genes responding to insect feeding.
    BMC Genomics, 2008. 9: p. 57
    [PMID:18230180]