PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.007G035500.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family B3
Protein Properties Length: 300aa    MW: 33844.9 Da    PI: 9.9671
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.007G035500.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B359.17.8e-1914102192
                         EEEE-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                         ffkv    + ++s++l+lp  f  ++ g++++ +k  tl+d + + W+v l   k+ g  v+++GWkeF+  + L +gDf++Fk+dg+sef
  Potri.007G035500.2  14 FFKVY--LSDFSSRQLSLPPAFGIQFnGKNEALPKNATLKDGNAKIWQVGL--VKREGDWVIKDGWKEFACYHSLVDGDFLIFKYDGSSEF 100
                         77887..88899999*******777779999********************..9999999***************************9999 PP

                         .. CS
                  B3  91 el 92 
                         e 
  Potri.007G035500.2 101 EV 102
                         54 PP

2B353.54.3e-172122821689
                         EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
                  B3  16 lvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                          ++pkkf++e++++   +k+++l+desg+ W v+ + + ++  +vlt+G +eF++ n+L  +D +vF+++ +++
  Potri.007G035500.2 212 ARIPKKFLRENNIE--LPKEIKLRDESGKLWPVQTSLWDSG-YTVLTSGFSEFCRMNKLVPRDQCVFTFICSKG 282
                         47*********866..889****************999886.789***********************998533 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086312.87212108IPR003340B3 DNA binding domain
SuperFamilySSF1019363.73E-1813108IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.2E-1813108IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.6E-1514108IPR003340B3 DNA binding domain
PfamPF023624.2E-1714102IPR003340B3 DNA binding domain
CDDcd100177.03E-1714105No hitNo description
Gene3DG3DSA:2.40.330.101.1E-18195294IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.32E-18196287IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.616197296IPR003340B3 DNA binding domain
SMARTSM010192.7E-10201296IPR003340B3 DNA binding domain
PfamPF023621.6E-14212283IPR003340B3 DNA binding domain
CDDcd100176.16E-14213285No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MVKPKRNVSF SNEFFKVYLS DFSSRQLSLP PAFGIQFNGK NEALPKNATL KDGNAKIWQV  60
GLVKREGDWV IKDGWKEFAC YHSLVDGDFL IFKYDGSSEF EVELYGNDGL KNNGLKKEGR  120
GLENKLSIHV KEELETEEDF IGSRPSTGCK QKDSNIEPRI TRSQGLFGKS GPKSSETKIA  180
KLGECKGAKA PSSVPREVPR FVMNITKITR FARIPKKFLR ENNIELPKEI KLRDESGKLW  240
PVQTSLWDSG YTVLTSGFSE FCRMNKLVPR DQCVFTFICS KGNLCNVIQV QVVRRGPRT*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.007G035500.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024461032.10.0putative B3 domain-containing protein At5g66980
TrEMBLA0A2K1ZNR60.0A0A2K1ZNR6_POPTR; Uncharacterized protein
STRINGPOPTR_0007s11890.11e-170(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66980.13e-31B3 family protein