PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.007G029500.1
Common NamePOPTR_0007s12450g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 205aa    MW: 23834.1 Da    PI: 6.3098
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.007G029500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.65e-1949102457
                         -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
            Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                         ++++++eq++ Le  F +++++  e++ +LA +lgL+ rqV vWFqNrRa++k+
  Potri.007G029500.1  49 KRKLNEEQVNLLEMNFGNEHKLESERKDKLALELGLDPRQVAVWFQNRRARWKN 102
                         45899***********************************************95 PP

2HD-ZIP_I/II117.67e-3848139293
         HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                         +kr+l++eqv+lLE++F +e+kLe+erK +la eLgl+prqvavWFqnrRAR+k+k+lE++y++Lk+++++++ e+++Le+ev +L+e+l+
  Potri.007G029500.1  48 RKRKLNEEQVNLLEMNFGNEHKLESERKDKLALELGLDPRQVAVWFQNRRARWKNKKLEEEYTKLKTSHENIVVEKCQLESEVLKLKEQLS 138
                         8****************************************************************************************98 PP

         HD-ZIP_I/II  93 e 93 
                         e
  Potri.007G029500.1 139 E 139
                         6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.19643103IPR001356Homeobox domain
SMARTSM003891.3E-1746107IPR001356Homeobox domain
SuperFamilySSF466892.44E-1747110IPR009057Homeodomain-like
CDDcd000862.62E-1548104No hitNo description
PfamPF000462.9E-1649102IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.5E-1950110IPR009057Homeodomain-like
PRINTSPR000312.1E-57483IPR000047Helix-turn-helix motif
PROSITE patternPS00027078101IPR017970Homeobox, conserved site
PRINTSPR000312.1E-58399IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MSYKLEDHMA LTSQLYPGVF TQMVPQQGES KPRRRRKKNK DADLSGARKR KLNEEQVNLL  60
EMNFGNEHKL ESERKDKLAL ELGLDPRQVA VWFQNRRARW KNKKLEEEYT KLKTSHENIV  120
VEKCQLESEV LKLKEQLSEA EKEIQRLSDR IDGVSTNSPS SSLSMAMDPP FLGEFAMEGY  180
EDAAFYMPPE NNYIPGMEWI NLYM*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13350RRRKKNKDADLSGARKRK
23550RKKNKDADLSGARKRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.104780.0bud
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, flowers and siliques. {ECO:0000269|PubMed:16055682}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.007G029500.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (ABA) and by salt stress. {ECO:0000269|PubMed:16055682}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002310795.21e-150homeobox-leucine zipper protein ATHB-40
SwissprotO232084e-77ATB40_ARATH; Homeobox-leucine zipper protein ATHB-40
TrEMBLA0A2K1ZNF31e-149A0A2K1ZNF3_POPTR; Uncharacterized protein
STRINGPOPTR_0007s12450.11e-149(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47893257
Representative plantOGRP37761025
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.13e-69homeobox protein 40
Publications ? help Back to Top
  1. González-Grandío E, et al.
    Abscisic acid signaling is controlled by a BRANCHED1/HD-ZIP I cascade in Arabidopsis axillary buds.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(2): p. E245-E254
    [PMID:28028241]