PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.007G026300.1
Common NamePOPTR_0007s12760g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 595aa    MW: 65404.7 Da    PI: 4.6083
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.007G026300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS348.79.7e-1072285943374
                GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                         ++L+ecA+ v+s+  + a + L + ++l+s++gdp++R+ +yf+e+L +r+a    +  + l+  ++   +s+e + ++k++++++P+ kf
  Potri.007G026300.1 228 KALVECAQLVESKADQ-AVKSLVKCKDLVSENGDPVERAGFYFAEGLCRRVAV---GELDVLKNFDQ---TSEEFTLSYKALNDACPYSKF 311
                         79********996655.55667789***************************9...33344444444...48999**************** PP

                GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         +hltaNqaIlea+e+++++Hi+Df+i +G+QW+aLlqaLa+R++g+p ++Ri g+ +p  g   + +l +tg+rL ++A+ lg++fef++ 
  Potri.007G026300.1 312 AHLTANQAILEATEKASKIHIVDFGIVHGVQWAALLQALATRSAGKPvRIRISGIPAPVLGknPAASLLATGNRLLDYAKLLGLNFEFEP- 401
                         *******************************************88777*********9988889999***********************. PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsle 272
                         + + +++l+ + +r +p+E+laVn++lql++lldes    +   + Lk+ ksl+P +v++ e ea++n+  +l+rf +al+yy+a+f+sle
  Potri.007G026300.1 402 ILTPIQELNESCFRAEPDEVLAVNFMLQLYNLLDESPVAVE---TALKMAKSLNPIIVTLGEYEASLNRVGYLTRFKNALRYYTAVFESLE 489
                         799******************************99988888...9********************************************** PP

                GRAS 273 aklpreseerikvErellgreivnvvacegae.rrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslv.l 360
                          +l+r+s er  vEr llg++i++vv  e+   rrer+e + +W   +e++GF++v+ls++a++qak ll  ++ sd y++++++  ++ l
  Potri.007G026300.1 490 PNLSRDSPERLQVERLLLGQRISSVVGPEEPGmRRERMEDKDQWGVLMESSGFESVSLSHYAMSQAKILLWYCNySDLYSLDDSQPGFLtL 580
                         ***************************998866*****************************************9*******99877777* PP

                GRAS 361 gWkdrpLvsvSaWr 374
                          W++ pL++vS+Wr
  Potri.007G026300.1 581 AWNEVPLLTVSSWR 594
                         *************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.926200572IPR005202Transcription factor GRAS
PfamPF035143.3E-104228594IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 595 aa     Download sequence    Send to blast
MAYMCADSGN LMAIAQQVIK QKQQQEQQQQ QSHHHHHNQQ QQFLGLNPFS LNPWPTNIMS  60
ANPNLGYGLS GPAAFSDPFQ SGQETGDPPV FSFSNMEQHH SSGFRLPYFT GAGGEFDSDE  120
WMDSLMNGGD STDSSNLPSG CDAWQNSTDF GMYTSDPFNT CPSRLTVGCS PPSDLNGVLS  180
NSLWVAPSPP QEIKPTTSPP PLLPPTVKNE TVGGSEEIVQ LSSSPVLKAL VECAQLVESK  240
ADQAVKSLVK CKDLVSENGD PVERAGFYFA EGLCRRVAVG ELDVLKNFDQ TSEEFTLSYK  300
ALNDACPYSK FAHLTANQAI LEATEKASKI HIVDFGIVHG VQWAALLQAL ATRSAGKPVR  360
IRISGIPAPV LGKNPAASLL ATGNRLLDYA KLLGLNFEFE PILTPIQELN ESCFRAEPDE  420
VLAVNFMLQL YNLLDESPVA VETALKMAKS LNPIIVTLGE YEASLNRVGY LTRFKNALRY  480
YTAVFESLEP NLSRDSPERL QVERLLLGQR ISSVVGPEEP GMRRERMEDK DQWGVLMESS  540
GFESVSLSHY AMSQAKILLW YCNYSDLYSL DDSQPGFLTL AWNEVPLLTV SSWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-1452235941375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.103520.0bud| catkin
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ5118630.0KJ511863.1 Populus euphratica GRAS/SCL transcription factor (SCL7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002310226.20.0hypothetical protein POPTR_0007s12760g
SwissprotQ9FL030.0SCL4_ARATH; Scarecrow-like protein 4
TrEMBLB9HEW40.0B9HEW4_POPTR; Uncharacterized protein
STRINGPOPTR_0007s12760.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP67991519
FabidsOGEF62803449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66770.10.0GRAS family protein