PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.007G024100.1
Common NamePOPTR_0007s12970g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ZF-HD
Protein Properties Length: 332aa    MW: 36754.2 Da    PI: 9.5709
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.007G024100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.33.2e-32114169359
         ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                         ++rY+eClkNhAas+Ggh++DGCgEfmp  geegt +++kCaAC+CHRnFHRre + 
  Potri.007G024100.1 114 STRYRECLKNHAASMGGHVLDGCGEFMPG-GEEGTLESFKCAACECHRNFHRREIDG 169
                         679*************************9.999********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.5E-29115167IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015665.8E-30116167IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257746.0E-22117173IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.647117166IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.602.4E-29257329IPR009057Homeodomain-like
SuperFamilySSF466899.23E-19260328IPR009057Homeodomain-like
PROSITE profilePS500718.633265329IPR001356Homeobox domain
TIGRFAMsTIGR015652.2E-27267324IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MELRGQDKGI VMPKSLNYNP PDNRDSSSKV PNSAPARRDH HHAAAVLPHA LGHQSLYQQQ  60
QQQQAQKPTT DLDLTPDPVQ ATTPIATTGA INTAQTPSRS LSRSPPPTPA SSASTRYREC  120
LKNHAASMGG HVLDGCGEFM PGGEEGTLES FKCAACECHR NFHRREIDGE PQCVANSTLY  180
KISNGQRNIL PPQHLVTSCA PRQPFPHQHH RYHQGTLSAY TTPIAPMIMS FGRGDGGGAA  240
AESSSEDLNM YQSNLQGQAS VQPSMSRKRF RTKFSQDQKD KMTEFAEKLG WRIQKQDEQE  300
VQQFCSQVGV KRKVFKVWMH NNKQAMKKKQ V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A4e-222683251875ZF-HD homeobox family protein
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.120660.0bud| catkin
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.007G024100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1487350.0EF148735.1 Populus trichocarpa x Populus deltoides clone WS0137_D14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006380765.10.0zinc-finger homeodomain protein 6
RefseqXP_024461197.10.0zinc-finger homeodomain protein 6
TrEMBLU5GAU40.0U5GAU4_POPTR; Uncharacterized protein
STRINGPOPTR_0007s12970.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20634253
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75240.16e-58homeobox protein 33