PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.007G016600.1
Common NamePOPTR_0007s13700g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GATA
Protein Properties Length: 377aa    MW: 41808.3 Da    PI: 7.2976
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.007G016600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA60.71.9e-19292326135
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                         Cs+Cg+ kTp+WR gp+g+ktLCnaCG++y++ +l
  Potri.007G016600.1 292 CSHCGVQKTPQWRAGPNGSKTLCNACGVRYKSGRL 326
                         *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.4E-16286340IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.624286322IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.09E-14287349No hitNo description
Gene3DG3DSA:3.30.50.102.8E-15290324IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.16E-14291339No hitNo description
PfamPF003202.4E-17292326IPR000679Zinc finger, GATA-type
PROSITE patternPS003440292317IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MLSSLIQCFT KLFSSPKFTT PSLLSFSYPL RFRFKKQEME CVEGALKTSF RKEMAMKFSP  60
QVLDDFWAVN VPNGMSSDDF SVEKLLDFSN ENDFIEEEEE EGGDKEKPCV FSVSVSPKQE  120
ALEEDKNSDS SPGFAVKDDF FSVPTSELCV PTDDFASLEW LSHFVEDSNS EYAAPFPTNV  180
SPPEPKKENP VEQEKLVLEE PLFKTPVPGK ARSKRTRNGV RVWPLGSPSL TESSSSSSST  240
SSSSPSSPWL VYSKPCLKVE PVWFEKPVAK KMKKPAVEAA AKGCGSNSSR RCSHCGVQKT  300
PQWRAGPNGS KTLCNACGVR YKSGRLLPEY RPACSPTFSK ELHSNHHRKV LEMRRNKEGL  360
VPTEPGLAQP FVPSFG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.16640.0bud| catkin
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002310287.20.0hypothetical protein POPTR_0007s13700g
SwissprotQ9FH574e-84GATA5_ARATH; GATA transcription factor 5
TrEMBLB9HFC80.0B9HFC8_POPTR; Uncharacterized protein
STRINGPOPTR_0007s13700.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51080.11e-54GATA transcription factor 6