PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.007G007100.1
Common NamePOPTR_0007s14720g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRF
Protein Properties Length: 615aa    MW: 66972.4 Da    PI: 7.8445
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.007G007100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC74.31.3e-23235279145
                 WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                         d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  Potri.007G007100.1 235 DQEPGRCRRTDGKKWRCSRDAVADQKYCERHINRGRHRSRKPVEG 279
                         689***************************************985 PP

2QLQ57.73.4e-20164200137
                 QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                         ++FT++Q+++L++Q+l+yKy+ a++PvP++L+ +++k
  Potri.007G007100.1 164 GPFTPSQWMELEHQALIYKYITARVPVPSNLIIPLKK 200
                         59******************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.3E-12164200IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.7E-14165198IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.49165200IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.796235279IPR014977WRC domain
PfamPF088793.6E-20237278IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 615 aa     Download sequence    Send to blast
MDFGVLGLEG LVGPESSSHA PSHVSLPETK PKILGSVLTK QERSSSSASA QDDYWRASKM  60
PKLDDFSSTK TMPLHQPAPL LRPNSMFSND SRQQEHMLSF SSPKPEATPF LVKDAGLVER  120
NTQNHTALSF PYYQHAPLSA SRSAGYGTGN LNASMQGPFT GVRGPFTPSQ WMELEHQALI  180
YKYITARVPV PSNLIIPLKK SLNPYGLPFS SAGSFPPSSL GWGTFHLGYP GNNTDQEPGR  240
CRRTDGKKWR CSRDAVADQK YCERHINRGR HRSRKPVEGQ TGHAATGTAS SKVVPMSNSM  300
PTSITTSGAT SNSIVITQQQ LKNFQPAAAS MSSADARVNG AQDARRVSMM SSTINRKSDE  360
STFCIPRQDI LFEQCSQTEF GLVSYDSLLN PSQKSSYFNA KPYESFLNFS DEESHDQHPL  420
RQFIDDWPKD QSNRSVISWP EELKSDCTQL SMSISMVSSD FSSSSSSLLR EKLAFSPLRL  480
SREFDPIQMG LRVSGDHNES SQKQANWIPI SWGTSIGGPL GEVLTTSASH ADSCKSSSAL  540
NLLREGWDGS PQLGSSPTGV LQKSTFGSLS NSSSGSSPRA ESKKNNESAS LYEDVVGSII  600
ASDPLFHPCN QENG*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.007G007100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU2826820.0GU282682.1 Populus balsamifera isolate POR11 haplotype A unknown protein gene, partial sequence.
GenBankGU2826830.0GU282683.1 Populus balsamifera isolate POR11 haplotype B unknown protein gene, partial sequence.
GenBankGU2826840.0GU282684.1 Populus balsamifera isolate STO11 haplotype A unknown protein gene, partial sequence.
GenBankGU2826850.0GU282685.1 Populus balsamifera isolate STO11 haplotype B unknown protein gene, partial sequence.
GenBankGU2826860.0GU282686.1 Populus balsamifera isolate WHR03 haplotype A unknown protein gene, partial sequence.
GenBankGU2826870.0GU282687.1 Populus balsamifera isolate WHR03 haplotype B unknown protein gene, partial sequence.
GenBankGU2826880.0GU282688.1 Populus balsamifera isolate FBK13 haplotype A unknown protein gene, partial sequence.
GenBankGU2826890.0GU282689.1 Populus balsamifera isolate FBK13 haplotype B unknown protein gene, partial sequence.
GenBankGU2826900.0GU282690.1 Populus balsamifera isolate FRE01 haplotype A unknown protein gene, partial sequence.
GenBankGU2826910.0GU282691.1 Populus balsamifera isolate FRE01 haplotype B unknown protein gene, partial sequence.
GenBankGU2826940.0GU282694.1 Populus balsamifera isolate HAY07 haplotype A unknown protein gene, partial sequence.
GenBankGU2826950.0GU282695.1 Populus balsamifera isolate HAY07 haplotype B unknown protein gene, partial sequence.
GenBankGU2826960.0GU282696.1 Populus balsamifera isolate MGR10 haplotype A unknown protein gene, partial sequence.
GenBankGU2826970.0GU282697.1 Populus balsamifera isolate MGR10 haplotype B unknown protein gene, partial sequence.
GenBankGU2826980.0GU282698.1 Populus balsamifera isolate NWL07 haplotype A unknown protein gene, partial sequence.
GenBankGU2826990.0GU282699.1 Populus balsamifera isolate NWL07 haplotype B unknown protein gene, partial sequence.
GenBankGU2827000.0GU282700.1 Populus balsamifera isolate STL13 haplotype A unknown protein gene, partial sequence.
GenBankGU2827010.0GU282701.1 Populus balsamifera isolate STL13 haplotype B unknown protein gene, partial sequence.
GenBankGU2827020.0GU282702.1 Populus balsamifera isolate INU03 haplotype A unknown protein gene, partial sequence.
GenBankGU2827030.0GU282703.1 Populus balsamifera isolate INU03 haplotype B unknown protein gene, partial sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002310328.30.0growth-regulating factor 1
TrEMBLA0A2K1ZLZ80.0A0A2K1ZLZ8_POPTR; Uncharacterized protein
STRINGPOPTR_0007s14720.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20853481
Representative plantOGRP33571226
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.11e-105growth-regulating factor 1