PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.006G279100.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Trihelix
Protein Properties Length: 317aa    MW: 36896.4 Da    PI: 5.527
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.006G279100.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix31.45.1e-1039119185
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdql 85 
                         +Wt +e l L++    +e++  ++ +  ++W+ + +++    + r+ +qC+ kw++l ++y  ik+++k+ +s+s     ++ +l
  Potri.006G279100.2  39 EWTTKEALILVNEIAAVEKDCLKALSTYQKWKIIVDNCVVLDVARNLNQCRTKWNSLVNEYNLIKNWDKESESRS----DFYWSL 119
                         5********************************************************************964433....466666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138371.2E-838120No hitNo description
PROSITE profilePS500906.6094096IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MEVIVNKKKR RKEQRESKNN NQLRVSSSTP RTRSQVSPEW TTKEALILVN EIAAVEKDCL  60
KALSTYQKWK IIVDNCVVLD VARNLNQCRT KWNSLVNEYN LIKNWDKESE SRSDFYWSLE  120
SERRREFGLP ENFNDELFRA IDDYMWCHKE HPDTDPDPDP DPDTDSEKPD LLHAITNPEN  180
HQTCCTNEKP QSILAETQLQ ESHEEEKPQK CRRKENSQNA HGDEKPKIHR GRKKKMPSTE  240
EMKQMMVEKL HENAEMIQAV VNGNFPEMAD LEAADSKNIE GFKTDLIRRQ GDKLIACLQN  300
IVNSINQFPC LLQECD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1610KKKRR
2611KKKRRK
3711KKRRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.93370.0bud| catkin| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1474660.0EF147466.1 Populus trichocarpa clone WS01231_H23 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006371828.11e-153hypothetical protein POPTR_0018s04010g
TrEMBLU5FFL41e-153U5FFL4_POPTR; Uncharacterized protein
STRINGPOPTR_0018s04010.11e-152(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31270.12e-50sequence-specific DNA binding transcription factors