PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.006G279100.1
Common NamePOPTR_0006s29340g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Trihelix
Protein Properties Length: 460aa    MW: 53622.6 Da    PI: 4.9942
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.006G279100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix30.59.6e-1039119185
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdql 85 
                         +Wt +e l L++    +e++  ++ +  ++W+ + +++    + r+ +qC+ kw++l ++y  ik+++k+ +s+s     ++ +l
  Potri.006G279100.1  39 EWTTKEALILVNEIAAVEKDCLKALSTYQKWKIIVDNCVVLDVARNLNQCRTKWNSLVNEYNLIKNWDKESESRS----DFYWSL 119
                         5********************************************************************964433....466666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138372.4E-838120No hitNo description
PROSITE profilePS500906.6094096IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 460 aa     Download sequence    Send to blast
MEVIVNKKKR RKEQRESKNN NQLRVSSSTP RTRSQVSPEW TTKEALILVN EIAAVEKDCL  60
KALSTYQKWK IIVDNCVVLD VARNLNQCRT KWNSLVNEYN LIKNWDKESE SRSDFYWSLE  120
SERRREFGLP ENFNDELFRA IDDYMWCHKE HPDTDPDPDP DPDTDSEKPD LLHAITNPGT  180
KKQRWRSKSL RTPMEEKTHK CCREDNSQTI HAEEKPQERC VEENSQIYCT VEKPQRVHAE  240
EEHQESQVQE STQIYNAGGK LQTIHAEEDP QESCAEEEPH TIHAEEEPEE SPAEEHPQPC  300
CSKEKPRAIH LEEETQERYL EENHQTCCTN EKPQSILAET QLQESHEEEK PQKCRRKENS  360
QNAHGDEKPK IHRGRKKKMP STEEMKQMMV EKLHENAEMI QAVVNGNFPE MADLEAADSK  420
NIEGFKTDLI RRQGDKLIAC LQNIVNSINQ FPCLLQECD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1610KKKRR
2611KKKRRK
3711KKRRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.93370.0bud| catkin| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1474660.0EF147466.1 Populus trichocarpa clone WS01231_H23 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006382204.10.0hypothetical protein POPTR_0006s29340g
TrEMBLA9PGH60.0A9PGH6_POPTR; Uncharacterized protein
STRINGPOPTR_0006s29340.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP74821314
FabidsOGEF67322633
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31270.15e-41sequence-specific DNA binding transcription factors
Publications ? help Back to Top
  1. Ralph SG, et al.
    Analysis of 4,664 high-quality sequence-finished poplar full-length cDNA clones and their utility for the discovery of genes responding to insect feeding.
    BMC Genomics, 2008. 9: p. 57
    [PMID:18230180]