PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.006G262100.4
Common NamePOPTR_0006s27800g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ARR-B
Protein Properties Length: 689aa    MW: 75483.6 Da    PI: 6.3607
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.006G262100.4genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.72.6e-28197250155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kpr++W+ eLH++Fv av+qL G++kA+Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  Potri.006G262100.4 197 KPRVVWSVELHRKFVAAVNQL-GIDKAVPKKILDLMNVEKLTRENVASHLQKYRL 250
                         79*******************.********************************8 PP

2Response_reg76.59.6e-26211291109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl vdD+p+ + ll+++l++ +y  v++++++  al +l+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++a+g+++++ + 
  Potri.006G262100.4  21 VLAVDDDPTCLLLLETLLRRCQY-TVTTTSQAITALSMLRENKnkFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSANGDPKLVMKG 109
                         799********************.***************888888*******************87754.558****************** PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         +  Ga d+l Kp+ +eel +
  Potri.006G262100.4 110 ITHGACDYLLKPVRIEELKN 129
                         *****************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.6E-1641688IPR017053Response regulator B-type, plant
SuperFamilySSF521722.7E-3618146IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.5E-4218161No hitNo description
SMARTSM004482.7E-3219131IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.16120135IPR001789Signal transduction response regulator, receiver domain
PfamPF000725.3E-2321129IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.56E-2322135No hitNo description
SuperFamilySSF466897.53E-20194254IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-30194255IPR009057Homeodomain-like
PROSITE profilePS5129412.269194253IPR017930Myb domain
TIGRFAMsTIGR015575.0E-25197250IPR006447Myb domain, plants
PfamPF002491.2E-6199249IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 689 aa     Download sequence    Send to blast
MTVEQGIGDS NIDQFPIGMR VLAVDDDPTC LLLLETLLRR CQYTVTTTSQ AITALSMLRE  60
NKNKFDLVIS DVHMPDMDGF KLLELVGLEM DLPVIMLSAN GDPKLVMKGI THGACDYLLK  120
PVRIEELKNI WQHVIRRRKY DNKDRNSSDN RDKPNQGSSE AIPDQKLNKK RKDQNEDEDE  180
DRDENEHENE DPATQKKPRV VWSVELHRKF VAAVNQLGID KAVPKKILDL MNVEKLTREN  240
VASHLQKYRL YLKRISTVAN QQANMVAALG SSDASYLQMN SMNGMGLHNL AGSGQFHNTP  300
FRSLPSSGML SRLNSPAVLG IRGLPSPGVI RLGHVQSAPH SANGLSHFQP VGHPGNNGNI  360
LQGMPMSLEL DQIQSNKGVN YVRELPTHLD DTASFPVSSG STDMKIIAGS SNSPFVGVSG  420
KPLMLEGHGQ GLQDGQKFGN QSSLAAGSLD PGYSSHFPDH GRCNDNWSNA VQSNGVQSSS  480
FTLNDCFKQS TLHPSSIRDS MSTMALQSRN NHCDVSSIST LPIHLQDSKA DLQCQVATMS  540
SDAGQIINNG QLGWDDHRQD DPYHANGISN SINSAIPING NGSLVGQSLD PNNMIFQRTR  600
SFSSAGQSNF VDTSLMKHNE VESSAMETLV RSKDGYLLGQ QKQQDSYVSN NFGSLEDLVS  660
VMVKQEQDKV KLPEGDFGCG GYSLRTCI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-26195256364ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.006G262100.4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFN9081440.0FN908144.1 Populus x canadensis mRNA for putative B-type response regulator 22 (rr22 gene), cultivar Dorskamp.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024459850.10.0two-component response regulator ARR12 isoform X1
TrEMBLA0A2K2A8M00.0A0A2K2A8M0_POPTR; Two-component response regulator
STRINGPOPTR_0006s27800.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-125response regulator 12