PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.006G251700.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HB-other
Protein Properties Length: 359aa    MW: 40539.7 Da    PI: 5.9536
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.006G251700.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.21.6e-09269318453
                         -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
            Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                         R +++k  +e+Le+++++++ p+ +++  + + ++L+ ++V  WF  +Ra
  Potri.006G251700.3 269 RKRLKKVHVETLERVYRRTKRPTNTMISSIVHVTNLPRKRVVKWFEDKRA 318
                         78899999****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.442263318IPR001356Homeobox domain
SMARTSM003891.9E-4265327IPR001356Homeobox domain
SuperFamilySSF466892.13E-8265320IPR009057Homeodomain-like
CDDcd000866.00E-7269318No hitNo description
Gene3DG3DSA:1.10.10.603.2E-8269320IPR009057Homeodomain-like
PfamPF000464.2E-7269318IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002229Biological Processdefense response to oomycetes
GO:0009414Biological Processresponse to water deprivation
GO:0009682Biological Processinduced systemic resistance
GO:0009787Biological Processregulation of abscisic acid-activated signaling pathway
GO:0010118Biological Processstomatal movement
GO:0050832Biological Processdefense response to fungus
GO:2000022Biological Processregulation of jasmonic acid mediated signaling pathway
GO:2000071Biological Processregulation of defense response by callose deposition
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MAFALSSSSA STAFQSLTSL HSSDGLHLRP SNLLLPRHSL ATSTLAFSRR RNHNSTVTSS  60
SKKKKKSVSK KEVREEDEID EDAFEALFGM LEEDLKSDDL STGDGDYENG DLSEKDLEKL  120
QRELEEALGV GGDDDVEVEM ASSVGDDVED NDGDEEEEEE GERPVMLKNW QLRRLARVLK  180
IGRRKTGIKS LAAELCLDRA IVLNLLRDPP PNLVMMSAAL PDEPAPTLVM PETKPSEIVP  240
EETREENVVK SESEMKLPVH VRQDSWFARK RLKKVHVETL ERVYRRTKRP TNTMISSIVH  300
VTNLPRKRVV KWFEDKRAGD GVPEHRNPFQ SEREFSSILR FRKVKRLLPN LSSGRQSL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14865RRRNHNSTVTSSSKKKKK
26170KKKKKSVSKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.89180.0bud| catkin
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.006G251700.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002308655.30.0protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3
TrEMBLA0A2K2A8250.0A0A2K2A825_POPTR; Uncharacterized protein
STRINGPOPTR_0006s26790.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11270.16e-66overexpressor of cationic peroxidase 3