PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.006G251200.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family CPP
Protein Properties Length: 714aa    MW: 78204.6 Da    PI: 6.0064
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.006G251200.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR47.14.7e-15482520341
                 TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                         +k+CnC+k+kClk+YC+Cfaag +C+  C C++C+N+ e
  Potri.006G251200.2 482 CKRCNCRKTKCLKLYCDCFAAGIYCAAICACQGCFNRPE 520
                         79**********************************876 PP

2TCR48.22.1e-15568606139
                 TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                         ++k gCnCk+s C+kkYCeC++a++ Cs+ C+Ce+C+N 
  Potri.006G251200.2 568 RHKTGCNCKRSMCVKKYCECYQANVGCSNACRCEGCRNI 606
                         5899**********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011145.5E-15480521IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163433.23481608IPR005172CRC domain
PfamPF036382.9E-11483518IPR005172CRC domain
SMARTSM011141.5E-15568609IPR033467Tesmin/TSO1-like CXC domain
PfamPF036387.9E-11571605IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 714 aa     Download sequence    Send to blast
MEGSPESFLC MLSRIVDESP FSNYISNLSP IKPVNTAHVA HGLLGINSPP LVFKSPHTAS  60
DRQINLLRRF QYPQISGAET SKIDDGSKKS IDGPEDMGKS SICLTSNLIV DAQTSDNVNN  120
SEQDQPGSSS GCVDEYLSDP VDADCADSVN LVNPNVKKSD DALQSSESNL TNLKIVESDD  180
INDKGTKGEV SQARPEQDGE DPKEQPTSEN KMEKIKEEGS LAKQPSHVCP NFGSDLLVDH  240
ASRQQCYTSG AQVAHPHELI QLITYNGSEV SQLQRGMSRR CLQFEQAQQE TTKDGTYSPN  300
PAINLFGSIS PASSTELEIL DSSQVELTIS SHKEQTMSAM FSANISGKCP VAVSKPSGIG  360
LHLNSIVNTL PMGSGASGPI MSHHLVENKI SCSKLSNLVE RVSLTAGDGV LQTKASLATS  420
STTSESFHNM ESFNNLQPPE HQVTPHNKRR FSSEHAGNFE DFSPSSPKKK RHKASSTDGD  480
GCKRCNCRKT KCLKLYCDCF AAGIYCAAIC ACQGCFNRPE YEDTVLETRQ QIESRNPLAF  540
APKIVQHVTE FQAIDVEDVD LFTPYSGRHK TGCNCKRSMC VKKYCECYQA NVGCSNACRC  600
EGCRNIHGRK EEYAMTQEIV SNRANEESLE GMADEKLEMV ANNKFLHTEL YDLRSLTPPT  660
PSFEYLSHEK DAPKSRLLPG RTRQMFHNLG CILEVLVSHL AVLFIGTVHQ LPQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1648360612121Protein lin-54 homolog
5fd3_B1e-1648360612121Protein lin-54 homolog
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.006G251200.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024460158.10.0CRC domain-containing protein TSO1 isoform X1
RefseqXP_024460159.10.0CRC domain-containing protein TSO1 isoform X1
TrEMBLA0A2K2A8210.0A0A2K2A821_POPTR; Uncharacterized protein
STRINGPOPTR_0006s26740.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.14e-47TESMIN/TSO1-like CXC 2