PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.006G237700.1
Common NamePOPTR_0006s25410g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GATA
Protein Properties Length: 374aa    MW: 41397.6 Da    PI: 6.5042
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.006G237700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA551.1e-17262296135
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                         C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  Potri.006G237700.1 262 CLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRL 296
                         99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169923.2E-7720352IPR016679Transcription factor, GATA, plant
SMARTSM004014.6E-17256306IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.149256292IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.6E-14257293IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577161.57E-15258320No hitNo description
CDDcd002029.61E-14261308No hitNo description
PfamPF003201.4E-15262296IPR000679Zinc finger, GATA-type
PROSITE patternPS003440262287IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MEAPELYGTT GFCSSQFTSN EKHHSLDSNK SIGGGDHFIV EDLLDFSNED EDAMVTDPSN  60
NNIVTPTTNS TDSSTVTFVD SCNSSSFSGC EPSGFNGDIG SHYTNNFSHH DVHLGSELCV  120
PYDDLAELEW LSNFVEESFS SEDLQRLQLI SGMKARPDES SETRHFQSDD NNNGNVSNIC  180
NNNTMFNPEM AVPAKARSKR SRAAPGNWAS RLLVLSRTTS SSEPEIIPGS TQHPNSGKKT  240
IKGAVGLKKR DGDVEGGDGR KCLHCATDKT PQWRTGPMGP KTLCNACGVR YKSGRLVPEY  300
RPAASPTFML TKHSNSHRKV LELRRQKEMV RAQQQHQHHQ YLHHHQNMVF DVSNGGDDYL  360
IHQHVGPDFR RMI*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the vascular cylinder of roots. Expressed in the differentiation zone of the root stele. {ECO:0000269|PubMed:25265867}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). Transcription activator involved in xylem formation. Functions upstream of NAC030/VND7, a master switch of xylem vessel differentiation (PubMed:25265867). {ECO:0000250|UniProtKB:Q8LAU9, ECO:0000269|PubMed:25265867}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00530DAPTransfer from AT5G25830Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.006G237700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024460548.10.0GATA transcription factor 12
SwissprotP697811e-94GAT12_ARATH; GATA transcription factor 12
TrEMBLA0A2K2A7A80.0A0A2K2A7A8_POPTR; GATA transcription factor
STRINGPOPTR_0006s25410.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13643395
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.11e-80GATA transcription factor 12
Publications ? help Back to Top
  1. Ravindran P,Verma V,Stamm P,Kumar PP
    A Novel RGL2-DOF6 Complex Contributes to Primary Seed Dormancy in Arabidopsis thaliana by Regulating a GATA Transcription Factor.
    Mol Plant, 2017. 10(10): p. 1307-1320
    [PMID:28917589]