PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.006G201700.1
Common NamePOPTR_0006s21630g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family M-type_MADS
Protein Properties Length: 470aa    MW: 50331.9 Da    PI: 7.5598
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.006G201700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF43.63.7e-141151343
                        --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
              SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                        i n+  r+ ++ kRr g+lKK +EL +LC++e+ vii+s++
  Potri.006G201700.1 11 IVNDAARKASLKKRRVGLLKKVSELTILCGIEAFVIIYSPD 51
                        679999*********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.4E-19160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.217149IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.88E-22294IPR002100Transcription factor, MADS-box
CDDcd002661.48E-25285No hitNo description
PRINTSPR004041.1E-5323IPR002100Transcription factor, MADS-box
PfamPF003193.9E-131151IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-52338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MTRKKVKLTW IVNDAARKAS LKKRRVGLLK KVSELTILCG IEAFVIIYSP DEPEPAVWPS  60
RPEVRQLLMR FQNMPDMERY KKMTNQESYL KERMAKLNDQ SRKHLKTNRE LEMAGLMQQV  120
YQDKGFDGLD QTQLRGLTLL VEEKMKEIRK RVEYFQQIPP LQPGAFPPGP FPSNHQDPNK  180
DDGGDDDGTS GQAGGESRDG RNNPKDGGAS WDHWFTDIIN NPEHNVAGGS SARNVLGRPH  240
LINFTGVSSG GGPDIGFHPG HNGGGGSSFR DIVGLGLPHS RNMGGIRGGH SFDLGQLPHE  300
NESLRGSSSA GGNNFDLRLP LGSNMTGGNN AGNSFDHWLP RGLGFNPGGN NSVGHNFDLD  360
LPQGNDVGGN STGGNNFDLW LPHVNNMGRN SAVVNNVDPW LARGDMGGEN LGLGLLPGSD  420
FAGSSTGGNP FHGLQGMHRR GYSGGGAGSA SGSDLGLPGS FGAGSRDIG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLTWIVNDAARKASLKKRR
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.006G201700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2101320.0AC210132.1 Populus trichocarpa clone POP011-D09, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002308328.10.0glycine-rich cell wall structural protein 1
TrEMBLB9H9L60.0B9H9L6_POPTR; Uncharacterized protein
STRINGPOPTR_0006s21630.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110141938
Representative plantOGRP11413173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.18e-32AGAMOUS-like 80