PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.006G191000.2
Common NamePOPTR_0006s20540g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 312aa    MW: 34701.4 Da    PI: 7.7836
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.006G191000.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.17.3e-32236290155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k+r+rWt++LHe+Fve+v++LGG+ekAtPk+il+lm+ +gLt+ hvkSHLQkYR+
  Potri.006G191000.2 236 KTRIRWTQDLHEKFVECVNRLGGAEKATPKAILNLMDSDGLTIFHVKSHLQKYRI 290
                         68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.011233293IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-28234291IPR009057Homeodomain-like
SuperFamilySSF466891.4E-16235290IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-23236291IPR006447Myb domain, plants
PfamPF002492.1E-8240289IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MNTRNIDCEE GVQQNHGVMI GDFVNLSSQY FGNQQIRNMA PRLQPAVMEA GCQQQNISPE  60
RSSSSILSRF ESPASSFYAT ERCMRFPQYD CQVGSSFCSQ YSKSYDSHQS SDPNYSINLG  120
EQADHNFGLN STLESVVKPH YSYYNSFDKS DKGLSSSSGN KLPSQQHNKF LDIHGTVSLG  180
NNFSVPFQGN QDRQVGCNPY SSPFAGLSFN SLEGKQSPRF SLGGGPTSSG KDLSSKTRIR  240
WTQDLHEKFV ECVNRLGGAE KATPKAILNL MDSDGLTIFH VKSHLQKYRI AKYMPEPSEV  300
AFKSERHCNY N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-23236293259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-23236293259Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-23236293158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-23236293158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-23236293158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-23236293158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-23236293259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-23236293259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-23236293259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-23236293259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-23236293259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-23236293259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.23600.0leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.006G191000.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1479700.0EF147970.1 Populus trichocarpa clone WS0126_F15 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002308371.30.0myb family transcription factor PHL5
TrEMBLA0A2K2A4J30.0A0A2K2A4J3_POPTR; Uncharacterized protein
STRINGPOPTR_0006s20540.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.24e-41G2-like family protein