PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.006G188000.1
Common NamePOPTR_0006s20220g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ARR-B
Protein Properties Length: 684aa    MW: 74838.3 Da    PI: 4.9935
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.006G188000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.11.7e-27209262155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kpr++W+ +LH++Fv av+q+ G +kA+Pk+il+lm+v+gLt+e+v+SHLQk+Rl
  Potri.006G188000.1 209 KPRVVWSVDLHQKFVAAVNQM-GLDKAVPKKILDLMNVDGLTRENVASHLQKFRL 262
                         79*******************.********************************8 PP

2Response_reg82.51.3e-27241321109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         +l vdD+p+ +++l+++l+k  y ev+++ ++  ale+l+e++  +Dl++ D++mp+mdG++ll+     e++lp+i++++hg++e + + 
  Potri.006G188000.1  24 ILAVDDDPICLKVLENLLRKCLY-EVTTTNQAVTALEMLRENRnkYDLVISDVNMPDMDGFKLLELVGL-EMDLPVIMLSSHGDKEFVYKG 112
                         799********************.***************999889*******************87754.558****************** PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         +  Ga d+l Kp+ +eel +
  Potri.006G188000.1 113 VTHGAVDYLLKPVRMEELKN 132
                         *****************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.0E-1661683IPR017053Response regulator B-type, plant
SuperFamilySSF521721.71E-3621148IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23004.0E-4221157No hitNo description
SMARTSM004483.3E-3522134IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.78123138IPR001789Signal transduction response regulator, receiver domain
PfamPF000725.8E-2524132IPR001789Signal transduction response regulator, receiver domain
CDDcd001568.06E-3125138No hitNo description
Gene3DG3DSA:1.10.10.604.4E-29206267IPR009057Homeodomain-like
PROSITE profilePS5129412.102206265IPR017930Myb domain
SuperFamilySSF466891.38E-18207266IPR009057Homeodomain-like
TIGRFAMsTIGR015577.8E-24209262IPR006447Myb domain, plants
PfamPF002492.3E-6211260IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 684 aa     Download sequence    Send to blast
MMAVDDQRGG NSVNEKKFPV GMRILAVDDD PICLKVLENL LRKCLYEVTT TNQAVTALEM  60
LRENRNKYDL VISDVNMPDM DGFKLLELVG LEMDLPVIML SSHGDKEFVY KGVTHGAVDY  120
LLKPVRMEEL KNIWQHVIRR KKWYPEDQNR SPNQDKGDDG AGEGEQGVTS TGSADQNGKL  180
NRKRKDQDDE DEEEGEDGDD NEVSGNQKKP RVVWSVDLHQ KFVAAVNQMG LDKAVPKKIL  240
DLMNVDGLTR ENVASHLQKF RLYLKRLSSG GNQQGNMVSA FGAKDSSYLQ MSSVDGFGDF  300
RSMHGPGRLS TTSLSSYPSG TFLGRLNSPG GLTLQGIASS GLHQPGLLPT NQGTNLFQGI  360
SSALEPKQLQ MKSINHIGEF NQKGDTAGFT LASCFPDVKV TIGSLSNTIS GATSSPPILQ  420
ANPQQNHNRG SLVTQSSLSM PSLNQESFDV GVQGSSNFLN HSRCDDNWQG AVQLSTFPSL  480
PIGEPFRHDQ LPSSTLRGNI SSTTCHIVNS PIDFSSTGSL TAPLEDSRVD MQGQTDFIGN  540
IFQNTTNYIS KNRWEENSQN YNPGLNGSFG AMNSLVSGNG SSGALNQSMD QRKRFGASMI  600
GQSNSGTLSM FQHPDVENFA LDPKMRSNED VILAQTKSQN GFVQNNYESL DDIMNEMIKQ  660
DQNDGSLMDG EFRFGSFSPG SCM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-25207268364ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.177260.0bud| leaf
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.006G188000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG5181560.0HG518156.1 Populus x canadensis RR18 gene for response regulator, cultivar Dorskamp.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002308388.30.0two-component response regulator ARR12 isoform X2
SwissprotB8AEH11e-125ORR23_ORYSI; Two-component response regulator ORR23
TrEMBLA0A2K2A4F10.0A0A2K2A4F1_POPTR; Two-component response regulator
STRINGPOPTR_0006s20220.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Representative plantOGRP29217120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-126response regulator 12