PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.006G150300.1
Common NamePOPTR_0006s15480g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 384aa    MW: 42514.4 Da    PI: 9.7767
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.006G150300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.67e-14179223347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+  ++ + ++lG+g+W+ I+r + ++Rt+ q+ s+ qky
  Potri.006G150300.1 179 PWTEEEHRTFLMGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKY 223
                         8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.032172228IPR017930Myb domain
SuperFamilySSF466891.94E-17172227IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-18175227IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.606.4E-12176222IPR009057Homeodomain-like
SMARTSM007174.8E-11176226IPR001005SANT/Myb domain
CDDcd001673.53E-9179224No hitNo description
PfamPF002491.8E-11179223IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006338Biological Processchromatin remodeling
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0035066Biological Processpositive regulation of histone acetylation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0004402Molecular Functionhistone acetyltransferase activity
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MRFFLFRTQV GEKYPTINYV HPIIFSWCAS IFVNPTLPHR HLTCIFTLSL SLSLSFSEFV  60
IRGCWLDVCL SKKLSSVWVK MGRKCSHCWN IGHNSRTCTT YRAAVAGGVR LFGVQLDISS  120
SSAAMRKSFS VDCLPSSSSP SSSLCSSRVS IDDNSDKPSV DYLSDVLLGP VQARKKGVPW  180
TEEEHRTFLM GLEKLGKGDW RGISRNFVTT RTPTQVASHA QKYFLRQAIV NKKKRRPSLF  240
DMAGSSSSSI TTSSHHVDGS RNTKQSDHPV PTYFKTSGSQ YATMHHDTST LPLLGISNSD  300
HEQGVKSDVQ ETKYSDELAP HNHSMPFLLH RVNDPLPKPS SSSKEMPPNV AVPDLELSLG  360
ASKSLENNNP SPSLLLIRPI RVT*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1231235KKKRR
2231236KKKRRP
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.006G150300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU2253740.0CU225374.1 Populus EST from leave.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002308294.30.0transcription factor MYBS3
TrEMBLA0A2K2A2R50.0A0A2K2A2R5_POPTR; Uncharacterized protein
STRINGPOPTR_0006s15480.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32133271
Representative plantOGRP3941699
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.17e-48MYB_related family protein